Result : Q2IV18
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | N(2)-fixation sustaining protein CowN (CO weal-nitrogenase) |
| NCBI Accession ID | CP000250.1 |
| Organism | Rhodopseudomonas palustris (strain HaA2) |
| Left | 3708940 |
| Right | 3709218 |
| Strand | + |
| Nucleotide Sequence | ATGTCGGGTTCGTTCGATCGTTACGTCAGCTTCAAGAATTCCAACTGGGAGGTTCGATCCGAACGCGTGATGGCGCGATTGCAGAAACACATCGACGCCGCGGAGAATCCGTTCTGGGCGTATTTTGCGCAGAAGCGCATCGAGCTGCGCGAGAAGCAGGGCCTCGACGATCTGCGCGTGCTGCACAATTATCTGCCGACGCTGCGTGAGTTGCTCGAGGACAATGGCGACCTCGAAACGCTGGCGATGCTTGAAGAACTGGAAGTGACCTTGATGTGA |
| Sequence | MSGSFDRYVSFKNSNWEVRSERVMARLQKHIDAAENPFWAYFAQKRIELREKQGLDDLRVLHNYLPTLRELLEDNGDLETLAMLEELEVTLM |
| Source of smORF | Swiss-Prot |
| Function | Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO. {ECO:0000255|HAMAP-Rule:MF_02117}. |
| Pubmed ID | |
| Domain | CDD:411285 |
| Functional Category | Others |
| Uniprot ID | Q2IV18 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2356511 | 2356789 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 2 | 2338737 | 2339012 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 3 | 881186 | 881458 | + | NC_011666.1 | Methylocella silvestris BL2 |
| 4 | 2586132 | 2586407 | + | NZ_AP018907.1 | Blastochloris tepida |
| 5 | 1739533 | 1739799 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 6 | 797802 | 798077 | - | NZ_CP012946.1 | Blastochloris viridis |
++ More..