Result : Q2IQM4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000251.1 |
| Organism | Anaeromyxobacter dehalogenans (strain 2CP-C) |
| Left | 1540898 |
| Right | 1541113 |
| Strand | - |
| Nucleotide Sequence | ATGTTCGGTCTCAGAATGCCGGAGCTGCTGCTCATCCTCGCGATCGTCGTGATCCTGTTCGGCGCGAGCCGGCTCCCGGCTCTCGGCGCGGGGCTCGGCCAGGGCATCCGCAGCTTCAAGAAGGCGTTCGGCGGCGAGGACGAGAAGCCCACCGCCTCCGGCAACGGCAGCACCCCGACGCAGTCGTCGTCGGACCAGGGCTCGAAGCAGGCTTGA |
| Sequence | MFGLRMPELLLILAIVVILFGASRLPALGAGLGQGIRSFKKAFGGEDEKPTASGNGSTPTQSSSDQGSKQA |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q2IQM4 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2898924 | 2899139 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 2 | 1533443 | 1533646 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
++ More..