Protein name |
Sec-independent protein translocase protein TatA |
NCBI Accession ID |
CP000251.1 |
Organism |
Anaeromyxobacter dehalogenans (strain 2CP-C) |
Left |
1540898 |
Right |
1541113 |
Strand |
- |
Nucleotide Sequence |
ATGTTCGGTCTCAGAATGCCGGAGCTGCTGCTCATCCTCGCGATCGTCGTGATCCTGTTCGGCGCGAGCCGGCTCCCGGCTCTCGGCGCGGGGCTCGGCCAGGGCATCCGCAGCTTCAAGAAGGCGTTCGGCGGCGAGGACGAGAAGCCCACCGCCTCCGGCAACGGCAGCACCCCGACGCAGTCGTCGTCGGACCAGGGCTCGAAGCAGGCTTGA |
Sequence |
MFGLRMPELLLILAIVVILFGASRLPALGAGLGQGIRSFKKAFGGEDEKPTASGNGSTPTQSSSDQGSKQA |
Source of smORF |
Swiss-Prot |
Function |
Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID |
|
Domain |
CDD:294511 |
Functional Category |
Others |
Uniprot ID |
Q2IQM4
|
ORF Length (Amino Acid) |
71 |