Result : Q2IPY3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0235 protein Adeh_1087 |
| NCBI Accession ID | CP000251.1 |
| Organism | Anaeromyxobacter dehalogenans (strain 2CP-C) |
| Left | 1255223 |
| Right | 1255510 |
| Strand | + |
| Nucleotide Sequence | ATGGCCTGGGCGCGCGACGAGGGCGGCGCGGCGGTGCTGGAGATCCTGGTCCAGCCGCGCGCCTCCCGCACCCGCGCGGTGGGCGAGCACGACGGCCGGCTCAAGATCCAGCTCGCGGCGCCCCCGGTGGACGGGGCGGCGAACGCCGCGCTGGTGGAGTTCCTGGCCGTGGCGCTGGGGGTCCGGCGGGCCGACGTGGCGCTCCTCCGCGGCGAGGCCGGGCGGCGGAAGACGGTCCGGGTGGCGGGGATCACCGCCGCGGCGGCCGTGGCCGCGCTGGCGCCCTGA |
| Sequence | MAWARDEGGAAVLEILVQPRASRTRAVGEHDGRLKIQLAAPPVDGAANAALVEFLAVALGVRRADVALLRGEAGRRKTVRVAGITAAAAVAALAP |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
| Pubmed ID | |
| Domain | CDD:412584 |
| Functional Category | Others |
| Uniprot ID | Q2IPY3 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1364542 | 1364829 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 2 | 6222483 | 6222734 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 3 | 4511677 | 4511937 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 4 | 951845 | 952096 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 5 | 1753329 | 1753580 | - | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 6 | 4033280 | 4033567 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 7 | 1520147 | 1520449 | - | NZ_CP030032.1 | Bradymonas sediminis |
| 8 | 268065 | 268358 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 9 | 216853 | 217119 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 10 | 1169465 | 1169794 | + | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 11 | 1030084 | 1030377 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 12 | 1140591 | 1140908 | - | NZ_CP021106.3 | Nitrosospira lacus |
| 13 | 6447205 | 6447468 | + | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 14 | 3848563 | 3848805 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
| 15 | 269885 | 270127 | - | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 16 | 1925090 | 1925347 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 17 | 2653710 | 2654003 | + | NZ_CP059467.1 | Aromatoleum bremense |
| 18 | 2130116 | 2130361 | + | NZ_CP029495.1 | Chromobacterium phragmitis |
| 19 | 8502802 | 8503038 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 20 | 907692 | 907943 | + | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 21 | 4588140 | 4588385 | - | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 22 | 360614 | 360859 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
++ More..