Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | CP000251.1 |
Organism | Anaeromyxobacter dehalogenans (strain 2CP-C) |
Left | 4116738 |
Right | 4117004 |
Strand | + |
Nucleotide Sequence | ATGGCTCGCGTCACCGTCGAAGACTGCCTCCCCATGGTGGACAACCGCTTCGCGCTCGTGCTGCTCGCGACCAAGCGGACCCGCCAGCTCATGGCCGGCGCCCGCCCGCTGCAGGCGGCGAGCAAGAACAAGCCGCCGGTCCTGGCGCTGCGCGAGATCGCCACGGGCAAGGTCCGCTTCGACCGCTCGGTGCGCGACGCCCTCTCCGGCAAGTTCGACAAGGAGAAGGTCAACATCCCGGCCGGCCAGACGCGGACGCTGCGCTAG |
Sequence | MARVTVEDCLPMVDNRFALVLLATKRTRQLMAGARPLQAASKNKPPVLALREIATGKVRFDRSVRDALSGKFDKEKVNIPAGQTRTLR |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | Q2IFJ5 |
ORF Length (Amino Acid) | 88 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4149414 | 4149680 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
2 | 6038707 | 6038943 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
3 | 6968542 | 6968781 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
4 | 2101383 | 2101661 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
5 | 6123084 | 6123320 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
6 | 2333555 | 2333791 | - | NZ_CP012109.1 | Myxococcus hansupus |
7 | 7085601 | 7085843 | - | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
8 | 3058629 | 3058868 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
9 | 3421175 | 3421417 | + | NZ_CP012333.1 | Labilithrix luteola |
10 | 3875458 | 3875706 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
11 | 4547777 | 4548040 | + | NZ_LR215729.2 | Pseudomonas marincola |
12 | 63279 | 63542 | - | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
13 | 3603715 | 3603966 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
14 | 2836066 | 2836326 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
15 | 1449450 | 1449713 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
16 | 1326641 | 1326901 | + | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
17 | 1706269 | 1706523 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
18 | 2873291 | 2873530 | + | NZ_CP030032.1 | Bradymonas sediminis |
19 | 7461557 | 7461799 | + | NC_013440.1 | Haliangium ochraceum DSM 14365 |
20 | 1159661 | 1159921 | + | NC_014315.1 | Nitrosococcus watsonii C-113 |