Result : Q2GLH5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | CP000235.1 |
| Organism | Anaplasma phagocytophilum (strain HZ) |
| Left | 154798 |
| Right | 155088 |
| Strand | + |
| Nucleotide Sequence | GTGTCGCATGGGGGTAAAAGACGTAGTGGAGATGGGGGTTCTGAAGGGAGTTCATATTCTCCTTTAGTGTACTTGAAGAGGCCATATTTTAGGAAATCTAGATCGTGTCCTTTAGCGCAGTGTCCTGATGAGGATATAGATTACAAGAATAAGGTATTGCTTTCGAAGTTTGTCTCTGAGTACGGCAGGATTCTTCCAAGTAGGATAACGTCTGTATCTGCTAGGAAGCAGAAGTTGCTGGCGCGTGCTATCAAGAGAGCTAGATATCTTGCTTTGCTGCCTTATTGCTAA |
| Sequence | MSHGGKRRSGDGGSEGSSYSPLVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 16482227 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2GLH5 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 154664 | 154954 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 2 | 96723 | 97013 | + | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 3 | 1114632 | 1114916 | - | NC_013532.1 | Anaplasma centrale str. Israel |
| 4 | 137751 | 138041 | + | NC_012026.1 | Anaplasma marginale str. Florida |
| 5 | 1155487 | 1155771 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
| 6 | 895616 | 895903 | - | NC_023063.1 | Ehrlichia muris AS145 |
| 7 | 977192 | 977476 | - | NC_007354.1 | Ehrlichia canis str. Jake |
| 8 | 287888 | 288172 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 9 | 3501586 | 3501822 | + | NZ_CP042582.1 | Hypericibacter adhaerens |
| 10 | 1299875 | 1300150 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 11 | 2700577 | 2700852 | - | NZ_CP060244.1 | Entomobacter blattae |
| 12 | 2382452 | 2382727 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 13 | 1143137 | 1143412 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 14 | 964158 | 964433 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 15 | 1844325 | 1844564 | + | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 16 | 1347635 | 1347883 | - | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 17 | 139610 | 139852 | - | NC_007940.1 | Rickettsia bellii RML369-C |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_021880.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01250.19 | 1.0 | 17 | 13 | same-strand | Ribosomal protein S6 |
| 2 | PF03948.16 | 1.0 | 17 | 18 | same-strand | Ribosomal protein L9, C-terminal domain |
| 3 | PF01281.21 | 1.0 | 17 | 18 | same-strand | Ribosomal protein L9, N-terminal domain |
++ More..