Result : Q2GH47
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S17 |
| NCBI Accession ID | |
| Organism | Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MREGKRKNMSNKKVLTGIVVDAKCDKTIKVMVSRMIMHKTYKKIVKKRKNYVVHDEHNQYKCGDVVKIQEHIPISATKRWIVI |
| Source of smORF | Swiss-Prot |
| Function | One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_01345}. |
| Pubmed ID | 16482227 |
| Domain | CDD:412327 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2GH47 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 212
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 395006 | 395257 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 2 | 784769 | 784996 | - | NC_023063.1 | Ehrlichia muris AS145 |
| 3 | 858949 | 859200 | - | NC_007354.1 | Ehrlichia canis str. Jake |
| 4 | 1012175 | 1012423 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
| 5 | 829762 | 829974 | - | NC_012026.1 | Anaplasma marginale str. Florida |
| 6 | 805850 | 806062 | - | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 7 | 409551 | 409763 | + | NC_013532.1 | Anaplasma centrale str. Israel |
| 8 | 277495 | 277710 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 9 | 1430424 | 1430666 | - | NZ_CP064063.1 | Brucella anthropi |
| 10 | 359304 | 359531 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 11 | 2692440 | 2692682 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 12 | 3562415 | 3562621 | - | NZ_CP041636.1 | Ferrovibrio terrae |
| 13 | 1446245 | 1446481 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 14 | 1536355 | 1536591 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 15 | 2475728 | 2475955 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 16 | 1106245 | 1106481 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 17 | 312504 | 312731 | - | NZ_CP012401.1 | Azospirillum thiophilum |
| 18 | 2000451 | 2000678 | - | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 19 | 3263144 | 3263371 | + | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 20 | 49022 | 49234 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 21 | 1274515 | 1274736 | + | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 22 | 1194494 | 1194736 | - | NC_010103.1 | Brucella canis ATCC 23365 |
| 23 | 1195605 | 1195847 | - | NC_004310.3 | Brucella suis 1330 |
| 24 | 1201393 | 1201635 | - | NC_009505.1 | Brucella ovis ATCC 25840 |
| 25 | 1201920 | 1202162 | - | NC_013119.1 | Brucella microti CCM 4915 |
| 26 | 792169 | 792411 | + | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 27 | 792159 | 792401 | + | NC_022905.1 | Brucella ceti TE10759-12 |
| 28 | 1210863 | 1211105 | - | NC_007618.1 | Brucella abortus 2308 |
| 29 | 1510934 | 1511176 | + | NZ_LT605585.1 | Brucella inopinata |
| 30 | 1281083 | 1281307 | - | NZ_LR134529.1 | Bartonella vinsonii |
| 31 | 924819 | 925046 | + | NZ_CP029353.1 | Azospirillum thermophilum |
| 32 | 1512460 | 1512672 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 33 | 1150819 | 1151055 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 34 | 3391664 | 3391882 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 35 | 1345164 | 1345382 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 36 | 5134142 | 5134390 | - | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 37 | 400800 | 401024 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 38 | 6127088 | 6127312 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 39 | 832927 | 833151 | + | NZ_CP031843.2 | Bartonella kosoyi |
| 40 | 4198434 | 4198658 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 41 | 3194299 | 3194520 | - | NZ_CP042906.1 | Hypericibacter terrae |
| 42 | 1512282 | 1512491 | + | NZ_CP012946.1 | Blastochloris viridis |
| 43 | 5157929 | 5158153 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 44 | 4056564 | 4056788 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 45 | 2213159 | 2213383 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 46 | 690060 | 690287 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 47 | 716216 | 716443 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 48 | 1194832 | 1195056 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 49 | 1602543 | 1602767 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 50 | 913907 | 914137 | + | NZ_AP019700.1 | Stella humosa |
| 51 | 571072 | 571281 | + | NZ_AP019773.1 | Bartonella quintana |
| 52 | 2637132 | 2637350 | + | NZ_CP072611.1 | Aureimonas populi |
| 53 | 5723386 | 5723610 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 54 | 1136878 | 1137102 | - | NZ_HG965802.1 | Bartonella henselae |
| 55 | 5867351 | 5867575 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 56 | 3427311 | 3427535 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 57 | 3966650 | 3966874 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 58 | 1854801 | 1855040 | - | NZ_CP035510.1 | Haematobacter massiliensis |
| 59 | 1292186 | 1292395 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 60 | 1911919 | 1912128 | - | NZ_AP018907.1 | Blastochloris tepida |
| 61 | 3563515 | 3563739 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 62 | 1479598 | 1479822 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 63 | 584895 | 585149 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 64 | 1586619 | 1586858 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 65 | 6281224 | 6281448 | - | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 66 | 2408195 | 2408425 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 67 | 1167747 | 1167983 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 68 | 1537207 | 1537443 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 69 | 5589823 | 5590047 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 70 | 3261079 | 3261288 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 71 | 1058859 | 1059122 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 72 | 1504436 | 1504672 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 73 | 156134 | 156343 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 74 | 4885914 | 4886132 | - | NZ_CP014168.1 | Sphingomonas panacis |
| 75 | 1308025 | 1308243 | + | NZ_CP024199.1 | Thalassospira marina |
| 76 | 507488 | 507697 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
| 77 | 1454068 | 1454280 | - | NZ_CP054836.1 | Oricola thermophila |
| 78 | 1525907 | 1526119 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 79 | 863919 | 864128 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 80 | 1085910 | 1086116 | - | NZ_CP053923.1 | Defluviicoccus vanus |
| 81 | 148630 | 148839 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 82 | 3933544 | 3933786 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 83 | 997324 | 997533 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 84 | 1236576 | 1236794 | - | NZ_CP023705.1 | Sphingomonas melonis |
| 85 | 152074 | 152283 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 86 | 1291023 | 1291259 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 87 | 1308004 | 1308222 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 88 | 2867819 | 2868028 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 89 | 2236668 | 2236877 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 90 | 929202 | 929411 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 91 | 939031 | 939240 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 92 | 945552 | 945761 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 93 | 1903746 | 1903964 | + | NZ_CP031555.1 | Thalassospira indica |
| 94 | 908743 | 908952 | - | NC_009881.1 | Rickettsia akari str. Hartford |
| 95 | 2574124 | 2574333 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 96 | 360815 | 361024 | + | NZ_CP013481.2 | Pandoraea apista |
| 97 | 250915 | 251124 | + | NZ_CP011568.3 | Pandoraea thiooxydans |
| 98 | 5014878 | 5015087 | - | NC_023018.2 | Pandoraea pnomenusa |
| 99 | 5488997 | 5489206 | - | NZ_CP010310.2 | Pandoraea pulmonicola |
| 100 | 1282959 | 1283168 | + | NZ_CP027770.1 | Staphylococcus felis |
| 101 | 3027498 | 3027722 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 102 | 2511805 | 2512032 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 103 | 539026 | 539253 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 104 | 1016637 | 1016864 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 105 | 813257 | 813466 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 106 | 4716903 | 4717127 | - | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 107 | 1081624 | 1081848 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 108 | 2108160 | 2108414 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 109 | 1081059 | 1081262 | + | NC_014313.1 | Hyphomicrobium denitrificans ATCC 51888 |
| 110 | 974765 | 975004 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
| 111 | 886622 | 886849 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 112 | 175472 | 175681 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 113 | 1976064 | 1976273 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 114 | 823501 | 823710 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 115 | 52366 | 52575 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 116 | 1858400 | 1858609 | - | NZ_CP041730.1 | Chitinimonas arctica |
| 117 | 185246 | 185455 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 118 | 205756 | 205965 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 119 | 712670 | 712879 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 120 | 1434712 | 1434921 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 121 | 758295 | 758504 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 122 | 790527 | 790736 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 123 | 899913 | 900122 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 124 | 2198013 | 2198222 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 125 | 1725719 | 1725928 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 126 | 2268883 | 2269092 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 127 | 2313023 | 2313232 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 128 | 4988167 | 4988376 | - | NZ_CP040336.1 | Bacillus luti |
| 129 | 125797 | 126006 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 130 | 131240 | 131449 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 131 | 131442 | 131651 | + | NC_011725.1 | Bacillus cereus B4264 |
| 132 | 131161 | 131370 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 133 | 1840924 | 1841178 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 134 | 138099 | 138308 | + | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 135 | 155450 | 155659 | + | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 136 | 132104 | 132313 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 137 | 759376 | 759585 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 138 | 2167409 | 2167618 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 139 | 726379 | 726588 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 140 | 793071 | 793280 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 141 | 1766779 | 1766988 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 142 | 708953 | 709162 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 143 | 648430 | 648639 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 144 | 134886 | 135095 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 145 | 1976952 | 1977161 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 146 | 329955 | 330164 | + | NZ_CP013235.1 | Collimonas arenae |
| 147 | 442350 | 442559 | + | NZ_CP013236.1 | Collimonas pratensis |
| 148 | 177371 | 177580 | + | NZ_CP037993.1 | Herbaspirillum huttiense |
| 149 | 151152 | 151361 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 150 | 716496 | 716705 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 151 | 167640 | 167849 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 152 | 247863 | 248096 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 153 | 2691336 | 2691545 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 154 | 1780887 | 1781096 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 155 | 2868789 | 2868995 | - | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 156 | 2799013 | 2799222 | - | NZ_CP029640.1 | Paraburkholderia dokdonella |
| 157 | 2538851 | 2539060 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 158 | 1388416 | 1388625 | + | NZ_CP021106.3 | Nitrosospira lacus |
| 159 | 2361992 | 2362201 | + | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 160 | 1986980 | 1987189 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 161 | 444863 | 445069 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 162 | 4496529 | 4496738 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 163 | 247991 | 248200 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 164 | 1220345 | 1220557 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 165 | 1055884 | 1056093 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 166 | 151165 | 151374 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 167 | 600870 | 601091 | + | NZ_CP027792.1 | Pulveribacter suum |
| 168 | 129626 | 129835 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 169 | 143200 | 143409 | + | NZ_CP012024.1 | Bacillus smithii |
| 170 | 166639 | 166848 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 171 | 146505 | 146714 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 172 | 1616018 | 1616227 | - | NZ_CP013661.2 | Planococcus kocurii |
| 173 | 146650 | 146859 | + | NZ_CP019401.1 | Planococcus faecalis |
| 174 | 242659 | 242868 | + | NZ_CP047361.1 | Macrococcus canis |
| 175 | 124432 | 124641 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 176 | 282128 | 282337 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 177 | 134477 | 134686 | + | NZ_CP016540.2 | Planococcus versutus |
| 178 | 4043404 | 4043613 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 179 | 146209 | 146418 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 180 | 1158370 | 1158579 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 181 | 1445897 | 1446133 | - | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 182 | 648198 | 648434 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 183 | 327324 | 327533 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 184 | 611497 | 611718 | + | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 185 | 132527 | 132736 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 186 | 3096054 | 3096263 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 187 | 132493 | 132702 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 188 | 2826145 | 2826354 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 189 | 140633 | 140842 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 190 | 2263659 | 2263868 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 191 | 275359 | 275583 | + | NC_022549.1 | Acholeplasma brassicae |
| 192 | 2120932 | 2121141 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 193 | 573840 | 574049 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 194 | 140142 | 140351 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 195 | 753601 | 753810 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 196 | 1667936 | 1668145 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 197 | 2118238 | 2118447 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 198 | 2535285 | 2535491 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 199 | 2132074 | 2132280 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 200 | 73712 | 73921 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 201 | 396025 | 396234 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 202 | 1496214 | 1496420 | - | NC_009511.1 | Sphingomonas wittichii RW1 |
| 203 | 1473955 | 1474164 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 204 | 204857 | 205066 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 205 | 1324215 | 1324457 | - | NC_004432.1 | Mycoplasma penetrans HF-2 |
| 206 | 1673969 | 1674172 | + | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 207 | 1137405 | 1137614 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 208 | 1009701 | 1009964 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 209 | 3394472 | 3394681 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 210 | 4311212 | 4311424 | - | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 211 | 1080645 | 1080848 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 212 | 237419 | 237622 | + | NC_016621.1 | Blattabacterium sp. (Cryptocercus punctulatus) str. Cpu |
| 213 | 1051560 | 1051784 | - | NC_014970.1 | Mycoplasma haemofelis str. Langford 1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007480.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00203.23 | 0.99 | 209 | 1777.0 | same-strand | Ribosomal protein S19 |
| 2 | PF00237.21 | 1.0 | 211 | 1391.0 | same-strand | Ribosomal protein L22p/L17e |
| 3 | PF00189.22 | 1.0 | 212 | 698 | same-strand | Ribosomal protein S3, C-terminal domain |
| 4 | PF07650.19 | 0.99 | 210 | 698 | same-strand | KH domain |
| 5 | PF00252.20 | 0.99 | 210 | 262 | same-strand | Ribosomal protein L16p/L10e |
| 6 | PF00831.25 | 1.0 | 212 | 55 | same-strand | Ribosomal L29 protein |
| 7 | PF00238.21 | 0.99 | 210 | 49 | same-strand | Ribosomal protein L14p/L23e |
| 8 | PF17136.6 | 0.98 | 207 | 450.0 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 9 | PF00467.31 | 0.85 | 181 | 448.0 | same-strand | KOW motif |
| 10 | PF00673.23 | 0.99 | 209 | 781 | same-strand | ribosomal L5P family C-terminus |
| 11 | PF00281.21 | 0.99 | 210 | 781 | same-strand | Ribosomal protein L5 |
| 12 | PF00253.23 | 0.98 | 207 | 1349 | same-strand | Ribosomal protein S14p/S29e |
| 13 | PF00410.21 | 0.97 | 206 | 1603.0 | same-strand | Ribosomal protein S8 |
++ More..