Result : Q2GGY3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP000236.1 |
| Organism | Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) |
| Left | 464699 |
| Right | 465001 |
| Strand | + |
| Nucleotide Sequence | ATGAGTAGGGTTTGTGATATTACAGGTCAGGGAAAGTCTTTTGGGAATAAGGTATCACACTCTAATCGTAAAACTAAAAGGGCTTATTTGGTTAACTTACATAATGTAACTTTAGTAAGCGATATTTTGAATAGGAAGTTTAAATTTAAAGTATCTAGTCGTACTTTAAGGACAGTAAATTATAAGGGTGGTTTGGATTTATATTTGCTTAACACATCGTCTAGAAAGTTGACTGATAAAGCTCAAAAAATAAAAAAACTAGTTAAAAATGCTGTGGCAAAAGGTGTGAAAGTTTCTTTATAA |
| Sequence | MSRVCDITGQGKSFGNKVSHSNRKTKRAYLVNLHNVTLVSDILNRKFKFKVSSRTLRTVNYKGGLDLYLLNTSSRKLTDKAQKIKKLVKNAVAKGVKVSL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 16482227 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2GGY3 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 64
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 456552 | 456854 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 2 | 793167 | 793469 | - | NC_007354.1 | Ehrlichia canis str. Jake |
| 3 | 720465 | 720767 | - | NC_023063.1 | Ehrlichia muris AS145 |
| 4 | 917220 | 917522 | + | NZ_CP040111.1 | Ehrlichia ruminantium |
| 5 | 766201 | 766512 | - | NC_012026.1 | Anaplasma marginale str. Florida |
| 6 | 468746 | 469057 | + | NC_013532.1 | Anaplasma centrale str. Israel |
| 7 | 746341 | 746652 | - | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 8 | 347485 | 347796 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 9 | 2457272 | 2457559 | + | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 10 | 1791557 | 1791844 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 11 | 2347536 | 2347823 | + | NZ_CP011452.2 | Croceibacterium atlanticum |
| 12 | 1085541 | 1085828 | - | NZ_CP016033.1 | Erythrobacter neustonensis |
| 13 | 443548 | 443838 | - | NZ_CP031357.1 | Erythrobacter aureus |
| 14 | 1912614 | 1912901 | - | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 15 | 1481574 | 1481864 | + | NZ_CP024920.1 | Qipengyuania seohaensis |
| 16 | 487796 | 488101 | - | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 17 | 2421776 | 2422063 | - | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 18 | 1782353 | 1782637 | + | NZ_CP022889.1 | Tsuneonella mangrovi |
| 19 | 1951551 | 1951847 | + | NZ_CP037948.1 | Qipengyuania sediminis |
| 20 | 554270 | 554548 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 21 | 2445201 | 2445485 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 22 | 402899 | 403189 | + | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 23 | 554849 | 555136 | - | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 24 | 1155312 | 1155596 | + | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 25 | 1044906 | 1045193 | + | NZ_CP053921.1 | Erythrobacter mangrovi |
| 26 | 231568 | 231852 | - | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 27 | 1876062 | 1876349 | - | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 28 | 415310 | 415600 | - | NZ_AP019389.1 | Qipengyuania flava |
| 29 | 3199539 | 3199826 | + | NZ_CP017057.1 | Erythrobacter litoralis |
| 30 | 2886758 | 2887039 | - | NZ_CP020083.1 | Blastomonas fulva |
| 31 | 264080 | 264388 | + | NZ_CP047224.1 | Neorickettsia findlayensis |
| 32 | 276217 | 276525 | + | NC_013009.1 | Neorickettsia risticii str. Illinois |
| 33 | 1461355 | 1461645 | + | NZ_CP053015.1 | Sphingomonas lacunae |
| 34 | 2221556 | 2221846 | + | NZ_CP060782.1 | Sphingomonas sediminicola |
| 35 | 2019289 | 2019573 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 36 | 1372395 | 1372685 | - | NZ_CP060780.1 | Sphingomonas daechungensis |
| 37 | 265024 | 265332 | + | NC_007798.1 | Neorickettsia sennetsu str. Miyayama |
| 38 | 3524750 | 3525043 | + | NZ_AP017655.1 | Sphingobium cloacae |
| 39 | 588410 | 588700 | - | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 40 | 78500 | 78796 | + | NZ_CP060718.1 | Sphingomonas lutea |
| 41 | 2749939 | 2750226 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 42 | 2065443 | 2065736 | + | NZ_CP060717.1 | Sphingomonas rhizophila |
| 43 | 1401051 | 1401344 | - | NZ_CP041659.1 | Sphingomonas xanthus |
| 44 | 1989850 | 1990152 | + | NZ_CP045434.1 | Sphingomonas ginsengisoli An et al. 2013 |
| 45 | 266315 | 266617 | + | NZ_CP007481.1 | Neorickettsia helminthoeca str. Oregon |
| 46 | 5130183 | 5130476 | - | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 47 | 297457 | 297744 | - | NC_006526.2 | Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 |
| 48 | 1704228 | 1704533 | - | NZ_CP042808.1 | Acetobacter oryzoeni |
| 49 | 187711 | 188001 | - | NZ_AP014946.1 | Variibacter gotjawalensis |
| 50 | 4944095 | 4944388 | - | NZ_CP009122.1 | Sphingopyxis fribergensis |
| 51 | 2231363 | 2231659 | - | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 52 | 1783219 | 1783512 | - | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 53 | 1755766 | 1756056 | - | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 54 | 3204532 | 3204822 | - | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
| 55 | 3162257 | 3162556 | - | NZ_CP048788.1 | Roseobacter ponti |
| 56 | 2920710 | 2921003 | - | NC_014006.1 | Sphingobium japonicum UT26S |
| 57 | 1927198 | 1927503 | - | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 58 | 3338603 | 3338896 | + | NZ_CP060035.1 | Sphingobium fuliginis |
| 59 | 1902706 | 1902999 | + | NZ_CP022745.1 | Sphingobium xenophagum |
| 60 | 1256075 | 1256371 | + | NZ_CP014168.1 | Sphingomonas panacis |
| 61 | 752640 | 752948 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 62 | 2899667 | 2899960 | + | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 63 | 602420 | 602725 | - | NC_021991.1 | Acetobacter pasteurianus 386B |
| 64 | 3109242 | 3109535 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
++ More..