Result : Q2GEY4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | CP000237.1 |
| Organism | Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama) (Ehrlichia sennetsu) |
| Left | 54279 |
| Right | 54500 |
| Strand | - |
| Nucleotide Sequence | ATGGCTCCGGTAGACGTTGAGTCTCAGGTTGAGCTTGATCTGAAGATCGAGGATTTTGATTACAAGAATGTGGCACTTATCAAGCGTTTCATGACCCCGGTCGGGCGCGTCTTGTCAAGAAGGGCCACTGGTTTAAGTGCGAAAAAGCAACGGAAGATGGCAAAGGAGGTTCGGAAGATGAAGTTCCTTGCACTTGTTCCGTACTGTGACCGCCACAAGTAA |
| Sequence | MAPVDVESQVELDLKIEDFDYKNVALIKRFMTPVGRVLSRRATGLSAKKQRKMAKEVRKMKFLALVPYCDRHK |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 16482227 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2GEY4 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 54279 | 54500 | - | NC_007798.1 | Neorickettsia sennetsu str. Miyayama |
| 2 | 54598 | 54852 | - | NC_013009.1 | Neorickettsia risticii str. Illinois |
| 3 | 54497 | 54679 | - | NZ_CP047224.1 | Neorickettsia findlayensis |
| 4 | 60950 | 61201 | - | NZ_CP007481.1 | Neorickettsia helminthoeca str. Oregon |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007798.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00206.22 | 1.0 | 4 | 520 | same-strand | Lyase |
| 2 | PF10415.11 | 0.75 | 3 | 4867 | same-strand | Fumarase C C-terminus |
| 3 | PF01138.23 | 1.0 | 4 | 2280.0 | same-strand | 3' exoribonuclease family, domain 1 |
| 4 | PF03726.16 | 1.0 | 4 | 2280.0 | same-strand | Polyribonucleotide nucleotidyltransferase, RNA binding domain |
| 5 | PF00575.25 | 1.0 | 4 | 2280.0 | same-strand | S1 RNA binding domain |
| 6 | PF03725.17 | 1.0 | 4 | 2280.0 | same-strand | 3' exoribonuclease family, domain 2 |
| 7 | PF00013.31 | 1.0 | 4 | 2280.0 | same-strand | KH domain |
| 8 | PF00312.24 | 1.0 | 4 | 2016.0 | same-strand | Ribosomal protein S15 |
| 9 | PF10397.11 | 1.0 | 4 | 507.0 | same-strand | Adenylosuccinate lyase C-terminus |
| 10 | PF01281.21 | 1.0 | 4 | 13.0 | same-strand | Ribosomal protein L9, N-terminal domain |
| 11 | PF03948.16 | 1.0 | 4 | 13.0 | same-strand | Ribosomal protein L9, C-terminal domain |
| 12 | PF01250.19 | 1.0 | 4 | 37.0 | same-strand | Ribosomal protein S6 |
| 13 | PF12849.9 | 1.0 | 4 | 625.0 | opposite-strand | PBP superfamily domain |
| 14 | PF07690.18 | 1.0 | 4 | 1617.5 | opposite-strand | Major Facilitator Superfamily |
| 15 | PF00892.22 | 1.0 | 4 | 2857.0 | same-strand | EamA-like transporter family |
| 16 | PF02104.17 | 0.75 | 3 | 4042 | opposite-strand | SURF1 family |
++ More..