Result : Q2GES3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | CP000237.1 |
| Organism | Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama) (Ehrlichia sennetsu) |
| Left | 101663 |
| Right | 101920 |
| Strand | + |
| Nucleotide Sequence | ATGTATTACCTGTTGTTTATGCTCAAAATAAGACTAGCAAGGTTCGGGAGGAAAAAGCGTCCGTACTATAAGATTGTGGTTGCAAATAGCTCCTCTCCAAGGGATGGGAAGTTTTTGGAACAAGTTGGTAGTTATGATCCCCTTTTGTCAAAGGACGATCCTCTGCGCGTTTGTCTAGATATAGAACGTATCCGGTACTGGACTAGTGTTGGTGCAAAGCCTACTGAGAGAGTTGCTAAGTTTGTTGCCTGTCTTTGA |
| Sequence | MYYLLFMLKIRLARFGRKKRPYYKIVVANSSSPRDGKFLEQVGSYDPLLSKDDPLRVCLDIERIRYWTSVGAKPTERVAKFVACL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 16482227 |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2GES3 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 119
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 101663 | 101920 | + | NC_007798.1 | Neorickettsia sennetsu str. Miyayama |
| 2 | 112897 | 113154 | + | NC_013009.1 | Neorickettsia risticii str. Illinois |
| 3 | 102384 | 102641 | + | NZ_CP047224.1 | Neorickettsia findlayensis |
| 4 | 99977 | 100240 | + | NZ_CP007481.1 | Neorickettsia helminthoeca str. Oregon |
| 5 | 198532 | 198795 | - | NC_007354.1 | Ehrlichia canis str. Jake |
| 6 | 149166 | 149429 | - | NC_023063.1 | Ehrlichia muris AS145 |
| 7 | 229706 | 229969 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
| 8 | 1015914 | 1016177 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 9 | 731811 | 732053 | + | NZ_CP009302.1 | Berryella intestinalis |
| 10 | 2826218 | 2826475 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 11 | 2762661 | 2762897 | - | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
| 12 | 3088140 | 3088373 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 13 | 6750510 | 6750764 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 14 | 1669968 | 1670213 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 15 | 6455014 | 6455262 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 16 | 27076 | 27288 | - | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 17 | 1005231 | 1005497 | + | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 18 | 3519490 | 3519726 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 19 | 3702087 | 3702329 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 20 | 3746839 | 3747081 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 21 | 38096 | 38344 | + | NC_012026.1 | Anaplasma marginale str. Florida |
| 22 | 28034 | 28282 | + | NC_013532.1 | Anaplasma centrale str. Israel |
| 23 | 1646403 | 1646648 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 24 | 2573663 | 2573911 | + | NZ_CP061800.1 | Desulfonema magnum |
| 25 | 2747011 | 2747268 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 26 | 563361 | 563609 | + | NZ_CP010427.1 | Allofrancisella guangzhouensis |
| 27 | 1438006 | 1438257 | + | NZ_CP046378.1 | Shewanella algae |
| 28 | 1479389 | 1479634 | - | NC_022549.1 | Acholeplasma brassicae |
| 29 | 5695193 | 5695411 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 30 | 58508 | 58741 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 31 | 3908128 | 3908391 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 32 | 414937 | 415200 | + | NC_004545.1 | Buchnera aphidicola str. Bp (Baizongia pistaciae) |
| 33 | 1376885 | 1377127 | + | NZ_CP048649.1 | Aminipila butyrica |
| 34 | 672851 | 673084 | + | NZ_CP009654.1 | Francisella frigiditurris |
| 35 | 2147487 | 2147744 | - | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 36 | 1707916 | 1708173 | - | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 37 | 2189792 | 2190046 | - | NZ_CP061799.1 | Desulfonema limicola |
| 38 | 1368177 | 1368425 | - | NZ_CP038017.1 | Allofrancisella frigidaquae |
| 39 | 1414383 | 1414640 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 40 | 2606735 | 2606977 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 41 | 1743704 | 1743952 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 42 | 2288677 | 2288919 | - | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 43 | 2369952 | 2370200 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 44 | 1169647 | 1169874 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 45 | 4550920 | 4551174 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 46 | 1180775 | 1181017 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 47 | 895383 | 895628 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 48 | 1526278 | 1526529 | + | NC_016901.1 | Shewanella baltica OS678 |
| 49 | 2031922 | 2032176 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 50 | 2881687 | 2881935 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 51 | 1502814 | 1503062 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 52 | 2221058 | 2221297 | - | NZ_CP048436.1 | Flavonifractor plautii |
| 53 | 2098625 | 2098873 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 54 | 1284293 | 1284541 | + | NZ_CP059565.1 | Neisseria wadsworthii |
| 55 | 73238 | 73486 | - | NZ_LR134313.1 | Neisseria canis |
| 56 | 3982972 | 3983223 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 57 | 2496563 | 2496808 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 58 | 299293 | 299541 | + | NZ_CP038241.1 | Allofrancisella inopinata |
| 59 | 368212 | 368463 | + | NZ_CP027432.2 | Caminibacter pacificus |
| 60 | 4738810 | 4739061 | - | NZ_CP027723.1 | Pseudomonas orientalis |
| 61 | 621237 | 621488 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 62 | 1175556 | 1175807 | + | NZ_CP041036.1 | Shewanella polaris |
| 63 | 3876735 | 3876986 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 64 | 3509323 | 3509574 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 65 | 4843163 | 4843414 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 66 | 4991259 | 4991510 | - | NZ_CP010896.1 | Pseudomonas simiae |
| 67 | 5176902 | 5177153 | - | NZ_CP027756.1 | Pseudomonas synxantha |
| 68 | 5583508 | 5583759 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 69 | 2928240 | 2928482 | - | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 70 | 854220 | 854474 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 71 | 894477 | 894725 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 72 | 766359 | 766604 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 73 | 4169161 | 4169421 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 74 | 4291725 | 4291985 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 75 | 2377977 | 2378228 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 76 | 1470402 | 1470653 | + | NZ_CP020472.1 | Shewanella japonica |
| 77 | 262047 | 262274 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 78 | 2431535 | 2431780 | + | NZ_CP039126.1 | Blautia producta |
| 79 | 257890 | 258144 | - | NZ_CP016312.1 | Thermus brockianus |
| 80 | 1951189 | 1951404 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 81 | 1796924 | 1797178 | - | NZ_CP041783.1 | Shewanella donghaensis |
| 82 | 705577 | 705813 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 83 | 5757353 | 5757598 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 84 | 1328351 | 1328596 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 85 | 313607 | 313855 | + | NZ_CP018804.1 | Histophilus somni |
| 86 | 993439 | 993693 | + | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 87 | 4049842 | 4050090 | - | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 88 | 2928734 | 2928997 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 89 | 854699 | 854947 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 90 | 722462 | 722716 | - | NZ_CP038452.1 | Thermus caldilimi |
| 91 | 4159147 | 4159395 | - | NC_008709.1 | Psychromonas ingrahamii 37 |
| 92 | 4472962 | 4473210 | + | NZ_CP028897.1 | Dongshaea marina |
| 93 | 502853 | 503077 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 94 | 189810 | 190031 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 95 | 1573868 | 1574086 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 96 | 1208245 | 1208460 | + | NZ_LN879430.1 | Herbinix luporum |
| 97 | 1706881 | 1707123 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 98 | 2044505 | 2044750 | + | NZ_CP028324.1 | Massilia armeniaca |
| 99 | 1207686 | 1207931 | - | NZ_LT821227.1 | Phoenicibacter congonensis |
| 100 | 1305434 | 1305658 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 101 | 81771 | 82007 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 102 | 2704622 | 2704873 | + | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 103 | 686953 | 687201 | - | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 104 | 1965693 | 1965941 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 105 | 1982353 | 1982607 | + | NZ_CP016171.1 | Bordetella bronchialis |
| 106 | 2515977 | 2516213 | - | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 107 | 397992 | 398201 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 108 | 2539999 | 2540244 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 109 | 2578890 | 2579138 | + | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 110 | 2262481 | 2262738 | + | NZ_CP011129.1 | Lysobacter antibioticus |
| 111 | 3275756 | 3276025 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 112 | 1620334 | 1620600 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 113 | 830593 | 830841 | + | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 114 | 788268 | 788528 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 115 | 1306509 | 1306757 | + | NZ_CP022358.1 | Shewanella bicestrii |
| 116 | 124645 | 124872 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 117 | 3420292 | 3420552 | + | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 118 | 1565759 | 1565986 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 119 | 1183002 | 1183262 | + | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 120 | 2084364 | 2084597 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP021876.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01782.20 | 0.91 | 108 | 232 | same-strand | RimM N-terminal domain |
| 2 | PF05239.18 | 0.81 | 96 | 194 | same-strand | PRC-barrel domain |
| 3 | PF00448.24 | 0.66 | 79 | 133.5 | same-strand | SRP54-type protein, GTPase domain |
| 4 | PF02881.21 | 0.66 | 78 | 133.5 | same-strand | SRP54-type protein, helical bundle domain |
| 5 | PF02978.21 | 0.66 | 79 | 97.5 | same-strand | Signal peptide binding domain |
| 6 | PF01746.23 | 0.87 | 104 | 770 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 7 | PF01245.22 | 0.78 | 93 | 1497.0 | same-strand | Ribosomal protein L19 |
++ More..