Result : A7HLA6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | CP000771.1 |
| Organism | Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) |
| Left | 914374 |
| Right | 914556 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGTACCAAAGCAGAAGCGTTCAAGCAGCAGAACACACCACAAAAGAGCAAAGATTTACAAAGCATTCAGCGTTGCGGTAACCACATGTCCAAACTGTGGCGCACCAAAACAACCACATAGAGTTTGCTTAAGATGTGGCTATTACGGTAAGAAGCAGGTGTTTGAGGTAGCGAAATGA |
| Sequence | MAVPKQKRSSSRTHHKRAKIYKAFSVAVTTCPNCGAPKQPHRVCLRCGYYGKKQVFEVAK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A7HLA6 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 54
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 914374 | 914556 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 2 | 1108868 | 1109050 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 3 | 1139896 | 1140078 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 4 | 500175 | 500357 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 5 | 818903 | 819085 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 6 | 1645854 | 1646036 | + | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 7 | 280793 | 280975 | - | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 8 | 1922176 | 1922358 | + | NZ_LS974202.1 | Mesotoga infera |
| 9 | 913872 | 914054 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 10 | 540002 | 540184 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 11 | 1968769 | 1968951 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 12 | 2003938 | 2004120 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 13 | 806868 | 807050 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 14 | 787795 | 787977 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 15 | 789214 | 789396 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 16 | 1527754 | 1527936 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 17 | 36718 | 36900 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 18 | 1299799 | 1299981 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 19 | 1191577 | 1191759 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 20 | 1535998 | 1536180 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 21 | 1941753 | 1941935 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 22 | 2029229 | 2029411 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 23 | 1709030 | 1709215 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 24 | 1378473 | 1378655 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 25 | 371238 | 371417 | - | NZ_LT635475.1 | Ezakiella massiliensis |
| 26 | 1033955 | 1034146 | + | NZ_LR134379.1 | Slackia heliotrinireducens |
| 27 | 1462250 | 1462426 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 28 | 3061365 | 3061565 | + | NZ_CP042430.1 | Baekduia soli |
| 29 | 1170976 | 1171155 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 30 | 3547202 | 3547381 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 31 | 1196628 | 1196807 | - | NC_014363.1 | Olsenella uli DSM 7084 |
| 32 | 1873945 | 1874130 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 33 | 997839 | 998018 | - | NZ_AP019367.1 | Parolsenella catena |
| 34 | 1858983 | 1859156 | + | NZ_CP058322.1 | Micromonospora carbonacea |
| 35 | 1208599 | 1208778 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 36 | 5229953 | 5230126 | + | NZ_AP022871.1 | Phytohabitans suffuscus |
| 37 | 2951180 | 2951356 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 38 | 9086164 | 9086337 | + | NZ_AP022870.1 | Phytohabitans flavus |
| 39 | 2509037 | 2509222 | + | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 40 | 2780422 | 2780598 | - | NZ_CP019870.1 | Clostridioides difficile |
| 41 | 1858766 | 1858954 | + | NC_023035.1 | Salinispira pacifica |
| 42 | 621022 | 621201 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
| 43 | 875114 | 875293 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 44 | 1999192 | 1999383 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 45 | 151834 | 152025 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 46 | 3597790 | 3597972 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 47 | 1153792 | 1153971 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 48 | 137691 | 137873 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 49 | 695115 | 695303 | + | NZ_CP029256.1 | Christensenella minuta |
| 50 | 239050 | 239232 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 51 | 678639 | 678824 | - | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 52 | 187141 | 187332 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 53 | 374293 | 374442 | - | NC_012115.1 | Nautilia profundicola AmH |
| 54 | 1930634 | 1930813 | + | NZ_CP045875.1 | Heliorestis convoluta |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009718.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02620.19 | 0.87 | 47 | 14 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 2 | PF02504.17 | 0.85 | 46 | 5.0 | same-strand | Fatty acid synthesis protein |
++ More..