Result : Q2G9D4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000248.1 |
| Organism | Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199) |
| Left | 1137023 |
| Right | 1137274 |
| Strand | + |
| Nucleotide Sequence | ATGGGTGGTCTTTCCCTTCCGCACCTGATCGTGCTGGCACTGGTCGTGCTGATCCTGTTCGGCCGTGGCCGCATTTCCGAAATGATGGGCGATTTCGGCAAGGGCATCAAAAGCTTCAAGCAGGGCATGAACGACGAGGACAGCAAGCCCGTCACCCCGCCGCCTGCCCAGATCCCGCCGGCATCGCTCCAGCAGACACCGCCGCCGGCCCAGCCCGCGCCGCAGCCGACTTCGACCGACCAGGCCCAGTAA |
| Sequence | MGGLSLPHLIVLALVVLILFGRGRISEMMGDFGKGIKSFKQGMNDEDSKPVTPPPAQIPPASLQQTPPPAQPAPQPTSTDQAQ |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q2G9D4 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1137023 | 1137274 | + | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 2 | 2839166 | 2839405 | - | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 3 | 2784151 | 2784357 | + | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 4 | 1102366 | 1102593 | + | NZ_AP019389.1 | Qipengyuania flava |
| 5 | 419889 | 420101 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 6 | 1263661 | 1263891 | + | NZ_CP031357.1 | Erythrobacter aureus |
| 7 | 1906774 | 1907013 | - | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 8 | 1849915 | 1850166 | - | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 9 | 2508848 | 2509093 | - | NZ_CP017057.1 | Erythrobacter litoralis |
| 10 | 304995 | 305225 | - | NZ_CP053921.1 | Erythrobacter mangrovi |
| 11 | 3193433 | 3193663 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 12 | 2356704 | 2356928 | + | NZ_CP022889.1 | Tsuneonella mangrovi |
| 13 | 1987530 | 1987757 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 14 | 3350676 | 3350912 | + | NZ_AP017655.1 | Sphingobium cloacae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP019389.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05746.17 | 0.77 | 10 | 3389.0 | same-strand | DALR anticodon binding domain |
| 2 | PF03485.18 | 0.77 | 10 | 3389.0 | same-strand | Arginyl tRNA synthetase N terminal domain |
| 3 | PF05036.15 | 0.85 | 11 | 2689 | same-strand | SPOR domain |
| 4 | PF00933.23 | 0.92 | 12 | 1532.0 | same-strand | Glycosyl hydrolase family 3 N terminal domain |
| 5 | PF04079.18 | 0.92 | 12 | 75.0 | same-strand | Segregation and condensation complex subunit ScpB |
| 6 | PF00902.20 | 1.0 | 13 | 458 | same-strand | Sec-independent protein translocase protein (TatC) |
| 7 | PF07969.13 | 0.62 | 8 | 1432.0 | opposite-strand | Amidohydrolase family |
| 8 | PF01979.22 | 0.62 | 8 | 1432.0 | opposite-strand | Amidohydrolase family |
| 9 | PF00291.27 | 0.62 | 8 | 3349.0 | same-strand | Pyridoxal-phosphate dependent enzyme |
++ More..