Result : Q2G632
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000248.1 |
| Organism | Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199) |
| Left | 2393557 |
| Right | 2393808 |
| Strand | - |
| Nucleotide Sequence | ATGGGAACCGTACCTGAACTGGCCAGTCTCAGCTTCGAAGAGGCTCTGAAGGAACTCGAGAACGTCGTCAGGCGACTGGAGAGCGGGGAAGCACCGCTCGACGAGTCGATCGAACTCTATGCCCGCGGAGACGCGCTGCGCGCGCATTGCCAGGCCCGCCTCGATGCGGCGCAGGCGCGAATCGAAGCGATCGTGGCCGACCGTGACGGCAAGGCCCAAGGCCTTCGTCCGTTCGACGAAACCGTCGGTTGA |
| Sequence | MGTVPELASLSFEEALKELENVVRRLESGEAPLDESIELYARGDALRAHCQARLDAAQARIEAIVADRDGKAQGLRPFDETVG |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q2G632 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 157
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2393557 | 2393808 | - | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 2 | 3789838 | 3790071 | + | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 3 | 2002263 | 2002487 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 4 | 2161526 | 2161744 | - | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 5 | 684639 | 684860 | + | NZ_CP037948.1 | Qipengyuania sediminis |
| 6 | 1745810 | 1746037 | + | NZ_CP053921.1 | Erythrobacter mangrovi |
| 7 | 1898851 | 1899060 | + | NZ_CP031357.1 | Erythrobacter aureus |
| 8 | 2129661 | 2129882 | + | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 9 | 1689010 | 1689237 | + | NZ_AP019389.1 | Qipengyuania flava |
| 10 | 840643 | 840864 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 11 | 165049 | 165270 | + | NZ_CP022889.1 | Tsuneonella mangrovi |
| 12 | 120371 | 120595 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 13 | 2886110 | 2886367 | - | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 14 | 402478 | 402696 | + | NZ_CP011452.2 | Croceibacterium atlanticum |
| 15 | 410693 | 410941 | - | NZ_CP020083.1 | Blastomonas fulva |
| 16 | 1615932 | 1616150 | + | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 17 | 139794 | 140045 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 18 | 2663001 | 2663222 | + | NZ_CP024920.1 | Qipengyuania seohaensis |
| 19 | 1679979 | 1680218 | + | NZ_CP023705.1 | Sphingomonas melonis |
| 20 | 1005422 | 1005643 | + | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 21 | 865965 | 866210 | - | NC_006526.2 | Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 |
| 22 | 1755739 | 1755960 | - | NZ_CP017057.1 | Erythrobacter litoralis |
| 23 | 3553504 | 3553743 | - | NZ_CP009571.1 | Sphingomonas taxi |
| 24 | 310855 | 311118 | + | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 25 | 1828221 | 1828445 | - | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 26 | 1938064 | 1938303 | + | NZ_CP035765.1 | Sphingomonas paucimobilis |
| 27 | 2306752 | 2307015 | - | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 28 | 2531867 | 2532088 | + | NZ_CP016033.1 | Erythrobacter neustonensis |
| 29 | 3564508 | 3564753 | + | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 30 | 1106667 | 1106909 | + | NZ_CP060718.1 | Sphingomonas lutea |
| 31 | 2186041 | 2186286 | + | NZ_CP061498.1 | Roseicitreum antarcticum |
| 32 | 20358 | 20603 | + | NC_009511.1 | Sphingomonas wittichii RW1 |
| 33 | 2347555 | 2347800 | + | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 34 | 411029 | 411247 | - | NZ_CP041659.1 | Sphingomonas xanthus |
| 35 | 150543 | 150800 | - | NZ_CP010522.1 | Liberibacter crescens |
| 36 | 956070 | 956297 | - | NZ_CP013500.1 | Rhizobium esperanzae |
| 37 | 4700372 | 4700614 | - | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 38 | 940729 | 940980 | - | NZ_CP020906.1 | Rhizobium etli |
| 39 | 3372791 | 3373042 | + | NZ_CP054027.1 | Rhizobium hidalgonense |
| 40 | 1020702 | 1020929 | - | NZ_CP071604.1 | Rhizobium binae |
| 41 | 2776568 | 2776795 | - | NZ_CP071454.1 | Rhizobium lentis |
| 42 | 601189 | 601440 | - | NZ_CP034998.1 | Rhizobium acidisoli |
| 43 | 1639675 | 1639902 | + | NZ_CP054021.1 | Rhizobium indicum |
| 44 | 1158147 | 1158398 | - | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 45 | 547437 | 547655 | - | NZ_CP061038.1 | Sphingomonas alpina |
| 46 | 845196 | 845456 | + | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 47 | 1131059 | 1131277 | - | NZ_CP041690.1 | Youhaiella tibetensis |
| 48 | 755579 | 755824 | + | NZ_CP060782.1 | Sphingomonas sediminicola |
| 49 | 1019743 | 1019970 | - | NZ_CP013532.1 | Rhizobium phaseoli |
| 50 | 990490 | 990741 | - | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 51 | 944538 | 944789 | - | NZ_CP071612.1 | Rhizobium bangladeshense |
| 52 | 280178 | 280396 | - | NZ_CP060780.1 | Sphingomonas daechungensis |
| 53 | 613891 | 614142 | - | NZ_CP022048.2 | Brevundimonas vesicularis |
| 54 | 2815881 | 2816132 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 55 | 2689554 | 2689811 | - | NZ_CP061205.1 | Kordiimonas pumila |
| 56 | 2306446 | 2306676 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 57 | 621985 | 622242 | - | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 58 | 560562 | 560813 | - | NZ_CP015880.1 | Ensifer adhaerens |
| 59 | 222285 | 222527 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 60 | 850121 | 850339 | + | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 61 | 1938012 | 1938233 | - | NZ_CP014168.1 | Sphingomonas panacis |
| 62 | 573000 | 573242 | + | NZ_CP060717.1 | Sphingomonas rhizophila |
| 63 | 244399 | 244653 | + | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 64 | 714793 | 715056 | + | NZ_CP009122.1 | Sphingopyxis fribergensis |
| 65 | 283618 | 283890 | - | NZ_CP022745.1 | Sphingobium xenophagum |
| 66 | 2840278 | 2840517 | - | NZ_CP042306.1 | Sphingomonas panacisoli |
| 67 | 734541 | 734759 | - | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 68 | 1063936 | 1064193 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 69 | 3574612 | 3574830 | + | NZ_CP032509.1 | Georhizobium profundi |
| 70 | 971126 | 971377 | - | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 71 | 79928 | 80155 | + | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 72 | 495723 | 495977 | - | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 73 | 2607955 | 2608200 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 74 | 1303749 | 1303994 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 75 | 504333 | 504587 | - | NZ_CP034909.1 | Ensifer alkalisoli |
| 76 | 257735 | 257953 | - | NZ_CP053015.1 | Sphingomonas lacunae |
| 77 | 2603787 | 2604041 | - | NZ_CP010803.1 | Martelella endophytica |
| 78 | 3293278 | 3293493 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 79 | 400744 | 400998 | - | NZ_CP053856.1 | Rhizobium pusense |
| 80 | 396981 | 397235 | - | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 81 | 1341854 | 1342108 | + | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 82 | 240550 | 240789 | + | NZ_CP045434.1 | Sphingomonas ginsengisoli An et al. 2013 |
| 83 | 4082736 | 4082963 | + | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 84 | 4684897 | 4685142 | + | NC_014217.1 | Starkeya novella DSM 506 |
| 85 | 1021874 | 1022128 | - | NZ_CP041238.1 | Ensifer mexicanus |
| 86 | 2831620 | 2831853 | + | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 87 | 114575 | 114817 | + | NZ_CP034588.1 | Silicimonas algicola |
| 88 | 4035538 | 4035792 | - | NZ_CP046908.1 | Stappia indica |
| 89 | 1143511 | 1143738 | - | NZ_CP032694.1 | Rhizobium jaguaris |
| 90 | 1111858 | 1112079 | + | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 91 | 3257995 | 3258210 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 92 | 2128501 | 2128740 | - | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 93 | 3568339 | 3568566 | - | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 94 | 3328278 | 3328496 | - | NC_014006.1 | Sphingobium japonicum UT26S |
| 95 | 3083719 | 3083937 | + | NZ_CP060035.1 | Sphingobium fuliginis |
| 96 | 2633220 | 2633435 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 97 | 1379526 | 1379771 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 98 | 542815 | 543042 | - | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 99 | 241327 | 241563 | + | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 100 | 511305 | 511559 | - | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 101 | 1040895 | 1041131 | + | NZ_CP045073.1 | Paracoccus kondratievae |
| 102 | 1223954 | 1224202 | + | NZ_CP016616.1 | Microvirga ossetica |
| 103 | 805216 | 805470 | - | NZ_LR723670.1 | Pseudorhizobium flavum |
| 104 | 2489184 | 2489441 | - | NZ_CP013002.1 | Caulobacter henricii |
| 105 | 917806 | 918057 | - | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 106 | 2610978 | 2611232 | + | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 107 | 3470136 | 3470393 | - | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 108 | 1003390 | 1003632 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 109 | 5083876 | 5084109 | - | NZ_CP026100.1 | Caulobacter flavus |
| 110 | 2219016 | 2219231 | + | NZ_CP054836.1 | Oricola thermophila |
| 111 | 5013674 | 5013889 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 112 | 1518587 | 1518829 | - | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 113 | 2143068 | 2143319 | + | NZ_CP012946.1 | Blastochloris viridis |
| 114 | 162519 | 162755 | + | NZ_CP019437.1 | Thioclava nitratireducens |
| 115 | 2148761 | 2148985 | - | NZ_CP035510.1 | Haematobacter massiliensis |
| 116 | 3559843 | 3560100 | + | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 117 | 1475478 | 1475702 | - | NZ_CP071057.1 | Marinicauda algicola |
| 118 | 24305 | 24523 | + | NZ_CP065915.1 | Pelagovum pacificum |
| 119 | 2827131 | 2827367 | - | NZ_LN832559.1 | Paracoccus aminovorans |
| 120 | 282326 | 282565 | - | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 121 | 1791940 | 1792182 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 122 | 170531 | 170767 | - | NZ_CP053562.1 | Thioclava electrotropha |
| 123 | 1743261 | 1743536 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 124 | 1396514 | 1396732 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 125 | 2649310 | 2649561 | + | NZ_AP018907.1 | Blastochloris tepida |
| 126 | 796177 | 796407 | - | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 127 | 1458446 | 1458697 | + | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 128 | 1295962 | 1296180 | + | NZ_CP044117.1 | Roseomonas mucosa |
| 129 | 709142 | 709378 | - | NZ_CP024422.1 | Paracoccus yeei |
| 130 | 1187053 | 1187289 | - | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 131 | 1157207 | 1157437 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 132 | 354220 | 354450 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 133 | 1476740 | 1476970 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 134 | 1741683 | 1741913 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 135 | 1196248 | 1196463 | + | NZ_CP030918.1 | Paracoccus suum |
| 136 | 561328 | 561543 | + | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 137 | 1325498 | 1325743 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 138 | 2095424 | 2095642 | - | NZ_CP046052.1 | Methylocystis heyeri |
| 139 | 1293516 | 1293734 | + | NZ_CP041025.1 | Paremcibacter congregatus |
| 140 | 1191806 | 1192063 | + | NC_011666.1 | Methylocella silvestris BL2 |
| 141 | 579917 | 580147 | + | NZ_CP019875.1 | Komagataeibacter nataicola |
| 142 | 1583523 | 1583747 | - | NZ_CP039964.1 | Pseudorhodobacter turbinis |
| 143 | 2615119 | 2615355 | + | NZ_CP060244.1 | Entomobacter blattae |
| 144 | 1677191 | 1677427 | - | NZ_CP062147.1 | Komagataeibacter hansenii |
| 145 | 2483306 | 2483539 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 146 | 890146 | 890376 | + | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 147 | 1132204 | 1132452 | + | NZ_CP053923.1 | Defluviicoccus vanus |
| 148 | 3010647 | 3010901 | + | NC_014830.1 | Intrasporangium calvum DSM 43043 |
| 149 | 1973953 | 1974183 | + | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 150 | 1404487 | 1404744 | + | NZ_CP024199.1 | Thalassospira marina |
| 151 | 3367466 | 3367675 | - | NZ_LN606600.1 | Acetobacter senegalensis |
| 152 | 759638 | 759868 | + | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 153 | 1413503 | 1413766 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 154 | 1990914 | 1991138 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 155 | 2003749 | 2004012 | + | NZ_CP031555.1 | Thalassospira indica |
| 156 | 2100130 | 2100345 | - | NZ_CP034328.1 | Tabrizicola piscis |
| 157 | 101648 | 101920 | + | NZ_LR134363.1 | Actinomyces slackii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007794.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00348.19 | 0.65 | 102 | 5.0 | same-strand | Polyprenyl synthetase |
++ More..