Result : Q2G026
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein translocase subunit SecG |
| NCBI Accession ID | CP000253.1 |
| Organism | Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Left | 784184 |
| Right | 784459 |
| Strand | + |
| Nucleotide Sequence | ATGATATACTACTTGTCGTATATAAGGAACGGAGGACAATTTATGCATACATTTTTAATCGTATTATTAATCATTGATTGTATTGCATTAATAACTGTTGTACTACTCCAAGAAGGTAAAAGCAGTGGACTTTCAGGTGCCATCAGTGGTGGTGCTGAGCAGTTATTCGGTAAACAAAAACAACGTGGCGTCGATTTATTCTTAAATAGATTAACAATTATTTTATCAATATTATTTTTTGTACTTATGATTTGCATAAGTTATCTTGGTATGTAA |
| Sequence | MIYYLSYIRNGGQFMHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTIILSILFFVLMICISYLGM |
| Source of smORF | Swiss-Prot |
| Function | Subunit of the protein translocation channel SecYEG (By similarity). While not essential, it considerably increases the export efficiency of extracellular proteins. {ECO:0000250, ECO:0000269|Pubmed:20472795}. |
| Pubmed ID | 20472795 |
| Domain | CDD:415590 |
| Functional Category | Others |
| Uniprot ID | Q2G026 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 160
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 809674 | 809949 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 2 | 784184 | 784459 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 3 | 810748 | 811023 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 2012392 | 2012625 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 5 | 151778 | 152011 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 6 | 2137233 | 2137466 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 7 | 1930692 | 1930925 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 8 | 1992529 | 1992762 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 9 | 475048 | 475281 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 10 | 141071 | 141304 | - | NZ_CP027770.1 | Staphylococcus felis |
| 11 | 1373033 | 1373266 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 12 | 1797809 | 1798042 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 13 | 541127 | 541360 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 14 | 2349642 | 2349875 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 15 | 478849 | 479082 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 16 | 2020267 | 2020500 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 17 | 518764 | 518997 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 18 | 2063416 | 2063649 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 19 | 864415 | 864639 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 20 | 2006572 | 2006805 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 21 | 1975403 | 1975636 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 22 | 1287928 | 1288161 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 23 | 443103 | 443336 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 24 | 1814472 | 1814705 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 25 | 1985357 | 1985590 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 26 | 268915 | 269148 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 27 | 1906688 | 1906921 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 28 | 3236123 | 3236356 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 29 | 659744 | 659977 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 30 | 752897 | 753130 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 31 | 2202635 | 2202871 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 32 | 2297353 | 2297586 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 33 | 3057383 | 3057616 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 34 | 2249296 | 2249529 | + | NZ_CP043404.1 | Bacillus safensis |
| 35 | 1094071 | 1094304 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 36 | 679516 | 679749 | + | NZ_CP047361.1 | Macrococcus canis |
| 37 | 1827653 | 1827886 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 38 | 2750138 | 2750371 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 39 | 2511192 | 2511425 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 40 | 3959484 | 3959717 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 41 | 521146 | 521379 | + | NZ_CP012024.1 | Bacillus smithii |
| 42 | 499628 | 499864 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 43 | 1099335 | 1099568 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 44 | 2553918 | 2554151 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 45 | 1362209 | 1362442 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 46 | 4369783 | 4370019 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 47 | 973021 | 973248 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 48 | 1065948 | 1066175 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 49 | 1098745 | 1098972 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 50 | 631324 | 631551 | - | NZ_CP013661.2 | Planococcus kocurii |
| 51 | 1138979 | 1139206 | + | NZ_CP019401.1 | Planococcus faecalis |
| 52 | 2716016 | 2716249 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 53 | 1205205 | 1205432 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 54 | 1079011 | 1079238 | + | NZ_CP016540.2 | Planococcus versutus |
| 55 | 3070500 | 3070727 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 56 | 2450498 | 2450731 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 57 | 717993 | 718223 | + | NZ_CP011937.1 | Bacillus velezensis |
| 58 | 3338440 | 3338670 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 59 | 140083 | 140316 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 60 | 3275046 | 3275279 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 61 | 3318249 | 3318479 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 62 | 3269656 | 3269886 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 63 | 3242476 | 3242706 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 64 | 3265803 | 3266033 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 65 | 3325813 | 3326043 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 66 | 2796506 | 2796736 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 67 | 3455093 | 3455323 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 68 | 4133004 | 4133225 | - | NZ_CP053989.1 | Niallia circulans |
| 69 | 897463 | 897687 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 70 | 3287444 | 3287677 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 71 | 4785341 | 4785565 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 72 | 1585921 | 1586154 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 73 | 3799596 | 3799823 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 74 | 899211 | 899438 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 75 | 2837536 | 2837772 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 76 | 3067858 | 3068094 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 77 | 2382684 | 2382914 | - | NZ_LR134483.1 | Listeria grayi |
| 78 | 2253198 | 2253434 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 79 | 781247 | 781483 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 80 | 3355800 | 3356024 | - | NZ_LS483476.1 | Lederbergia lentus |
| 81 | 2545797 | 2546030 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 82 | 2940409 | 2940642 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 83 | 2417790 | 2418023 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 84 | 2434919 | 2435152 | - | NZ_LT906444.1 | Listeria welshimeri |
| 85 | 4872533 | 4872766 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 86 | 5080095 | 5080328 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 87 | 5162013 | 5162240 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 88 | 299215 | 299448 | + | NZ_CP040336.1 | Bacillus luti |
| 89 | 2059504 | 2059737 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 90 | 577796 | 578029 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 91 | 225974 | 226210 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 92 | 2523835 | 2524068 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 93 | 728389 | 728622 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 94 | 3656537 | 3656767 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 95 | 232848 | 233087 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 96 | 3306764 | 3306994 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 97 | 4839176 | 4839409 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 98 | 5046669 | 5046902 | - | NC_011725.1 | Bacillus cereus B4264 |
| 99 | 4047068 | 4047292 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 100 | 1453723 | 1453956 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 101 | 2942045 | 2942278 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 102 | 546189 | 546419 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 103 | 294603 | 294827 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 104 | 2484256 | 2484528 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 105 | 2549057 | 2549290 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 106 | 3731099 | 3731332 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 107 | 2757378 | 2757608 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 108 | 955494 | 955721 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 109 | 413396 | 413617 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 110 | 4609051 | 4609287 | + | NZ_CP033433.1 | Cohnella candidum |
| 111 | 2681742 | 2681963 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 112 | 2732857 | 2733087 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 113 | 3291772 | 3292008 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 114 | 5023123 | 5023359 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 115 | 638971 | 639210 | + | NZ_AP019400.1 | Cohnella abietis |
| 116 | 3709265 | 3709498 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 117 | 749348 | 749578 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 118 | 2625865 | 2626095 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 119 | 5434724 | 5434945 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 120 | 229139 | 229372 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 121 | 504950 | 505186 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 122 | 3808323 | 3808556 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 123 | 1901200 | 1901430 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 124 | 928714 | 928944 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 125 | 76620 | 76853 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 126 | 2505992 | 2506213 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 127 | 840698 | 840928 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 128 | 3761651 | 3761881 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 129 | 757782 | 758012 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 130 | 1318005 | 1318238 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 131 | 1802774 | 1802995 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 132 | 230983 | 231216 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 133 | 183674 | 183907 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 134 | 3816319 | 3816549 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 135 | 186801 | 187034 | + | NZ_CP009288.1 | Paenibacillus durus |
| 136 | 3341859 | 3342098 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 137 | 3976351 | 3976572 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 138 | 2100474 | 2100707 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 139 | 185771 | 186004 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 140 | 2057033 | 2057266 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 141 | 191292 | 191525 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 142 | 181108 | 181341 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 143 | 2727378 | 2727611 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 144 | 193473 | 193706 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 145 | 1511754 | 1511987 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 146 | 1042069 | 1042299 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 147 | 810537 | 810779 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 148 | 253939 | 254172 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 149 | 642539 | 642769 | + | NC_014624.2 | Eubacterium callanderi |
| 150 | 3522629 | 3522859 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 151 | 107528 | 107758 | - | NZ_CP019962.1 | Eubacterium limosum |
| 152 | 683256 | 683486 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 153 | 257635 | 257868 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 154 | 516920 | 517147 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 155 | 682561 | 682791 | + | NZ_LR134484.1 | Gemella haemolysans |
| 156 | 767185 | 767412 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 157 | 3849570 | 3849803 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 158 | 2296636 | 2296869 | + | NZ_CP021434.1 | Tumebacillus avium |
| 159 | 3879545 | 3879775 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 160 | 962432 | 962662 | + | NZ_CP046314.1 | Gemella morbillorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134304.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00121.20 | 0.62 | 99 | 3501 | same-strand | Triosephosphate isomerase |
| 2 | PF06415.15 | 0.72 | 115 | 2156 | same-strand | BPG-independent PGAM N-terminus (iPGM N) |
| 3 | PF01676.20 | 0.72 | 115 | 2156 | same-strand | Metalloenzyme superfamily |
| 4 | PF00113.24 | 0.74 | 119 | 762 | same-strand | Enolase, C-terminal TIM barrel domain |
| 5 | PF03952.18 | 0.74 | 119 | 762 | same-strand | Enolase, N-terminal domain |
| 6 | PF12146.10 | 0.62 | 99 | 142.5 | same-strand | Serine aminopeptidase, S33 |
| 7 | PF00773.21 | 0.97 | 155 | 891 | same-strand | RNB domain |
| 8 | PF17876.3 | 0.97 | 155 | 891 | same-strand | Cold shock domain |
| 9 | PF08206.13 | 0.97 | 155 | 891 | same-strand | Ribonuclease B OB domain |
| 10 | PF00575.25 | 0.96 | 154 | 891.0 | same-strand | S1 RNA binding domain |
| 11 | PF01668.20 | 0.94 | 151 | 3375 | same-strand | SmpB protein |
++ More..