Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YnfO (Uncharacterized protein YnfO from Qin prophage) |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 1636756 |
Right | 1636989 |
Strand | + |
Nucleotide Sequence | ATGTCAACGAAGAACAGAACCCGCAGAACAACAACCCGCAACATCCGCTTTCCTAACCAAATGATTGAACAAATTAACATCGCTCTTGAGCAAAAAGGGTCCGGGAATTTCTCAGCCTGGGTCATTGAAGCCTGCCGCCGGAGACTGTGCTCAGAAAAAAGAGTTTCTTCTGAAGCAAACAAAGAAAAGAGTGACATTACTGAATTGCTCAGAAAACAGGTCAGACCAGATTGA |
Sequence | MSTKNRTRRTTTRNIRFPNQMIEQINIALEQKGSGNFSAWVIEACRRRLCSEKRVSSEANKEKSDITELLRKQVRPD |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam13132. Profile Description: Domain of unknown function (DUF3950). This presumed domain is functionally uncharacterized. This domain family is found in bacteria and viruses, and is approximately 30 amino acids in length. There is a conserved NFS sequence motif. |
Pubmed ID | 9278503 16738553 |
Domain | CDD:404101 |
Functional Category | Others |
Uniprot ID | Q2EES0 |
ORF Length (Amino Acid) | 77 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1636756 | 1636989 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1860555 | 1860788 | - | NZ_LR134340.1 | Escherichia marmotae |
3 | 1760639 | 1760872 | + | NZ_CP057657.1 | Escherichia fergusonii |
4 | 2234046 | 2234273 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
5 | 1947108 | 1947335 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
6 | 1779810 | 1780037 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
7 | 2690167 | 2690391 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
8 | 2182595 | 2182819 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
9 | 2130468 | 2130692 | + | NZ_AP014857.1 | Escherichia albertii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07471.14 | 1.0 | 4 | 389 | opposite-strand | Phage DNA packaging protein Nu1 |
2 | PF07166.13 | 0.75 | 3 | 58 | same-strand | Protein of unknown function (DUF1398) |
3 | PF00959.21 | 0.75 | 3 | 1824.0 | opposite-strand | Phage lysozyme |
4 | PF03245.15 | 1.0 | 4 | 859.5 | opposite-strand | Bacteriophage Rz lysis protein |
5 | PF05876.14 | 1.0 | 4 | 907 | opposite-strand | Phage terminase large subunit (GpA) |
6 | PF02831.17 | 1.0 | 4 | 2829 | opposite-strand | gpW |
7 | PF05136.15 | 1.0 | 4 | 3032 | opposite-strand | Phage portal protein, lambda family |
8 | PF01343.20 | 1.0 | 4 | 4614 | opposite-strand | Peptidase family S49 |