ProsmORF-pred
Result : Q2EEP9
Protein Information
Information Type Description
Protein name Putative uncharacterized protein YafF
NCBI Accession ID AP009048.1
Organism Escherichia coli (strain K12)
Left 239190
Right 239378
Strand +
Nucleotide Sequence ATGAATGAAGACGACTACAAAATAAGAAGAGGAAACGCAGCAGAATTATTTTCAGGGATACGGCACATTGCTATTAATATTTTGACGAATGAGAAGGTATTCAAGGCAGGGTTAAGACGTAAGATGCGAAAAGCAGCCATGGACAGAAACTACCTGGCGTCAGTCCTTGCGGGGAGCGGGCTTTCGTAG
Sequence MNEDDYKIRRGNAAELFSGIRHIAINILTNEKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS
Source of smORF Swiss-Prot
Function
Pubmed ID 9278503 16738553
Domain
Functional Category Others
Uniprot ID Q2EEP9
ORF Length (Amino Acid) 62
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 15
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 239190 239378 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 3625326 3625514 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 737773 737961 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
4 1532764 1532952 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
5 1368747 1368935 + NZ_LR134340.1 Escherichia marmotae
6 2230082 2230276 - NZ_LR134340.1 Escherichia marmotae
7 270602 270790 + NZ_AP014857.1 Escherichia albertii
8 1784512 1784700 - NZ_AP014857.1 Escherichia albertii
9 715186 715374 + NZ_AP014857.1 Escherichia albertii
10 273601 273789 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
11 815311 815499 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
12 2052138 2052326 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
13 664602 664790 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
14 1827958 1828146 + NZ_CP057657.1 Escherichia fergusonii
15 1026727 1026915 + NZ_CP057657.1 Escherichia fergusonii
16 491446 491634 + NZ_CP057657.1 Escherichia fergusonii
17 497399 497587 + NZ_CP057657.1 Escherichia fergusonii
18 3218638 3218826 + NZ_CP044098.1 Citrobacter portucalensis
19 3866540 3866728 + NC_012912.1 Dickeya chrysanthemi Ech1591
20 3869946 3870134 + NC_012912.1 Dickeya chrysanthemi Ech1591
21 1356086 1356274 + NZ_CP037951.1 Parashewanella tropica
22 2154790 2154978 + NZ_CP037951.1 Parashewanella tropica
23 1358364 1358552 + NZ_CP037951.1 Parashewanella tropica
24 3406740 3406928 - NZ_CP037951.1 Parashewanella tropica
25 2135993 2136181 - NZ_CP037951.1 Parashewanella tropica
26 1706062 1706250 - NZ_CP037951.1 Parashewanella tropica
27 3698725 3698913 + NZ_CP012621.1 Zobellella denitrificans
28 3699364 3699552 + NZ_CP012621.1 Zobellella denitrificans
29 3695366 3695554 + NZ_CP012621.1 Zobellella denitrificans
30 1618436 1618630 - NC_012691.1 Tolumonas auensis DSM 9187
31 120284 120484 + NZ_CP060401.1 Xenorhabdus nematophila
32 1721289 1721489 + NZ_FO704551.1 Xenorhabdus poinarii G6
33 686659 686838 + NZ_CP024793.1 Nostoc flagelliforme CCNUN1
34 1074241 1074441 + NZ_CP011104.1 Photorhabdus thracensis
35 288181 288381 - NZ_CP011104.1 Photorhabdus thracensis
36 1414471 1414671 - NZ_CP072455.1 Xenorhabdus budapestensis
37 5395757 5395954 - NC_008786.1 Verminephrobacter eiseniae EF01-2
38 3342189 3342386 - NC_008786.1 Verminephrobacter eiseniae EF01-2
++ More..