Result : Q253R9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AP006861.1 |
| Organism | Chlamydia felis (strain Fe/C-56) (Chlamydophila felis) |
| Left | 804287 |
| Right | 804514 |
| Strand | + |
| Nucleotide Sequence | ATGGAAGAAATTCCCTTTGAAAATGCTATGGAAAGGTTGGAAGAGATCGTAGATCTTATGAATCAACCCTCAACGTCTTTAGATTCTTCTTTAAAACTTTATGAAGAAGCTGATGCTTTAATGCGTATTTGCGAATCGCGCATTCGTAAAGCAGAAGACCGTGTACGCGAGTTATCCGAAAGGCGAAATGAAACTCTTCTTTCTGAAGAAGAATCTTTTGCGCATTAA |
| Sequence | MEEIPFENAMERLEEIVDLMNQPSTSLDSSLKLYEEADALMRICESRIRKAEDRVRELSERRNETLLSEEESFAH |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 16766509 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q253R9 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 804287 | 804514 | + | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 2 | 357202 | 357429 | - | NC_003361.3 | Chlamydia caviae GPIC |
| 3 | 359187 | 359414 | - | NC_017287.1 | Chlamydia psittaci 6BC |
| 4 | 1213629 | 1213856 | - | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 5 | 341489 | 341716 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 6 | 754142 | 754369 | - | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 7 | 418620 | 418838 | + | NZ_LS398098.1 | Chlamydia suis |
| 8 | 725967 | 726164 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 9 | 371725 | 371922 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007899.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03840.16 | 0.67 | 6 | 2849.0 | opposite-strand | Preprotein translocase SecG subunit |
| 2 | PF00121.20 | 1.0 | 9 | 1801 | opposite-strand | Triosephosphate isomerase |
| 3 | PF02601.17 | 0.67 | 6 | 4.0 | same-strand | Exonuclease VII, large subunit |
| 4 | PF13742.8 | 1.0 | 9 | 4 | same-strand | OB-fold nucleic acid binding domain |
| 5 | PF01336.27 | 0.67 | 6 | 4.0 | same-strand | OB-fold nucleic acid binding domain |
| 6 | PF13292.8 | 1.0 | 9 | 268 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 7 | PF02780.22 | 1.0 | 9 | 268 | same-strand | Transketolase, C-terminal domain |
| 8 | PF02779.26 | 1.0 | 9 | 268 | same-strand | Transketolase, pyrimidine binding domain |
| 9 | PF00398.22 | 0.67 | 6 | 2641.5 | opposite-strand | Ribosomal RNA adenine dimethylase |
++ More..