Result : Q24V01
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AP008230.1 |
| Organism | Desulfitobacterium hafniense (strain Y51) |
| Left | 2704249 |
| Right | 2704485 |
| Strand | - |
| Nucleotide Sequence | GTGAATAAAGAGTTATCCTTCGAAGAAGGGATCGAGCATTTAGAGCGTATTGTCCGTGAGCTTGAGCAAAAAGAGGTCCCTCTTGAGCAGGCACTGAATCTCTTTCGCCAGGGAATTGAGCTTGTTCAGAAATGCAATAACCAGCTTGATTATGCTGAAAAGCAAATGCAGATTCTCCTGGAGAATCCCAATGGGGAGTTGGAAGTACGCCCGGCCGATTTTCCTGTGGAAGGATGA |
| Sequence | MNKELSFEEGIEHLERIVRELEQKEVPLEQALNLFRQGIELVQKCNNQLDYAEKQMQILLENPNGELEVRPADFPVEG |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 16513756 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q24V01 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3725403 | 3725639 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 2 | 2932174 | 2932410 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 3 | 2466454 | 2466699 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 4 | 2049382 | 2049630 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 5 | 1061217 | 1061414 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 6 | 3475165 | 3475416 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 7 | 1074144 | 1074347 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 8 | 10320 | 10532 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 9 | 1410618 | 1410845 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011830.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01728.21 | 1.0 | 9 | 3821 | same-strand | FtsJ-like methyltransferase |
| 2 | PF01479.27 | 0.89 | 8 | 3822.5 | same-strand | S4 domain |
| 3 | PF13292.8 | 0.89 | 8 | 1934.5 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 4 | PF02779.26 | 0.89 | 8 | 1934.5 | same-strand | Transketolase, pyrimidine binding domain |
| 5 | PF02780.22 | 0.89 | 8 | 1934.5 | same-strand | Transketolase, C-terminal domain |
| 6 | PF02681.16 | 0.78 | 7 | 884 | same-strand | Divergent PAP2 family |
| 7 | PF00348.19 | 1.0 | 9 | 5 | same-strand | Polyprenyl synthetase |
| 8 | PF13742.8 | 1.0 | 9 | 38 | same-strand | OB-fold nucleic acid binding domain |
| 9 | PF01336.27 | 1.0 | 9 | 38 | same-strand | OB-fold nucleic acid binding domain |
| 10 | PF04961.14 | 0.78 | 7 | 2716 | same-strand | Formiminotransferase-cyclodeaminase |
| 11 | PF02882.21 | 1.0 | 9 | 3122 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 12 | PF00763.25 | 1.0 | 9 | 3122 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
++ More..