Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | AP008230.1 |
Organism | Desulfitobacterium hafniense (strain Y51) |
Left | 2704249 |
Right | 2704485 |
Strand | - |
Nucleotide Sequence | GTGAATAAAGAGTTATCCTTCGAAGAAGGGATCGAGCATTTAGAGCGTATTGTCCGTGAGCTTGAGCAAAAAGAGGTCCCTCTTGAGCAGGCACTGAATCTCTTTCGCCAGGGAATTGAGCTTGTTCAGAAATGCAATAACCAGCTTGATTATGCTGAAAAGCAAATGCAGATTCTCCTGGAGAATCCCAATGGGGAGTTGGAAGTACGCCCGGCCGATTTTCCTGTGGAAGGATGA |
Sequence | MNKELSFEEGIEHLERIVRELEQKEVPLEQALNLFRQGIELVQKCNNQLDYAEKQMQILLENPNGELEVRPADFPVEG |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 16513756 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | Q24V01 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3725403 | 3725639 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
2 | 2932174 | 2932410 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
3 | 2466454 | 2466699 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
4 | 2049382 | 2049630 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
5 | 1061217 | 1061414 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
6 | 3475165 | 3475416 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
7 | 1074144 | 1074347 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
8 | 10320 | 10532 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
9 | 1410618 | 1410845 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01728.21 | 1.0 | 9 | 3821 | same-strand | FtsJ-like methyltransferase |
2 | PF01479.27 | 0.89 | 8 | 3822.5 | same-strand | S4 domain |
3 | PF13292.8 | 0.89 | 8 | 1934.5 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
4 | PF02779.26 | 0.89 | 8 | 1934.5 | same-strand | Transketolase, pyrimidine binding domain |
5 | PF02780.22 | 0.89 | 8 | 1934.5 | same-strand | Transketolase, C-terminal domain |
6 | PF02681.16 | 0.78 | 7 | 884 | same-strand | Divergent PAP2 family |
7 | PF00348.19 | 1.0 | 9 | 5 | same-strand | Polyprenyl synthetase |
8 | PF13742.8 | 1.0 | 9 | 38 | same-strand | OB-fold nucleic acid binding domain |
9 | PF01336.27 | 1.0 | 9 | 38 | same-strand | OB-fold nucleic acid binding domain |
10 | PF04961.14 | 0.78 | 7 | 2716 | same-strand | Formiminotransferase-cyclodeaminase |
11 | PF02882.21 | 1.0 | 9 | 3122 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
12 | PF00763.25 | 1.0 | 9 | 3122 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |