Result : Q24T29
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | AP008230.1 |
| Organism | Desulfitobacterium hafniense (strain Y51) |
| Left | 3425859 |
| Right | 3426092 |
| Strand | - |
| Nucleotide Sequence | ATGCTGGCACTTACCCGTAAAGCAGGAGAACGCATCGTCATCGGCGATAATATCGTCGTCACCGTGGTCAGCATCAAAGGGGATAGCATCCGCCTGACCATCGATGCCCCGAAAGAGGTCAAAATCTACCGAGGGGAAATTTATGACGCTATCGCAGCGGAGAATAAAGAGGCTGCTGTTCCCATGGATCTGACAGAATTGACTGCTTTAAAGGAGTTTCATATCAGAAAATAG |
| Sequence | MLALTRKAGERIVIGDNIVVTVVSIKGDSIRLTIDAPKEVKIYRGEIYDAIAAENKEAAVPMDLTELTALKEFHIRK |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 16513756 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | Q24T29 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 56
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4439851 | 4440084 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 2 | 3552719 | 3552952 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 3 | 5105048 | 5105281 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 4 | 2520544 | 2520777 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 5 | 4090861 | 4091094 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 6 | 3532943 | 3533173 | - | NZ_CP036259.1 | Sporomusa termitida |
| 7 | 2956793 | 2957044 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 8 | 1221863 | 1222105 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 9 | 2564767 | 2565012 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 10 | 6594967 | 6595200 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 11 | 2008259 | 2008504 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 12 | 903031 | 903258 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 13 | 500155 | 500397 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 14 | 348433 | 348657 | + | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 15 | 3189801 | 3190037 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 16 | 5277197 | 5277433 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 17 | 1702287 | 1702529 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 18 | 2194736 | 2194963 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 19 | 24158 | 24391 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 20 | 581138 | 581365 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 21 | 2634902 | 2635144 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 22 | 1540467 | 1540691 | - | NC_018020.1 | Turneriella parva DSM 21527 |
| 23 | 3447072 | 3447314 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 24 | 619047 | 619265 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 25 | 4956602 | 4956841 | + | NC_014962.1 | Isosphaera pallida ATCC 43644 |
| 26 | 148219 | 148437 | + | NZ_LR699011.1 | Roseburia hominis |
| 27 | 3960741 | 3960962 | - | NZ_CP018477.1 | Thermogutta terrifontis |
| 28 | 570544 | 570789 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 29 | 1316458 | 1316706 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 30 | 2693365 | 2693589 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 31 | 4754514 | 4754753 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 32 | 2987338 | 2987550 | - | NZ_CP043930.1 | Gimesia benthica |
| 33 | 2500518 | 2500775 | - | NZ_CP063458.1 | Humisphaera borealis |
| 34 | 1345723 | 1345962 | - | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 35 | 691099 | 691338 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 36 | 4857743 | 4857973 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 37 | 3344894 | 3345121 | + | NC_016620.1 | Halobacteriovorax marinus SJ |
| 38 | 1307988 | 1308221 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 39 | 2335013 | 2335252 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 40 | 200091 | 200312 | + | NZ_CP059540.1 | Planococcus maritimus |
| 41 | 3178197 | 3178436 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 42 | 200237 | 200458 | + | NZ_CP016538.2 | Planococcus maritimus |
| 43 | 3391145 | 3391366 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 44 | 2012582 | 2012821 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 45 | 2570967 | 2571164 | - | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 46 | 2501497 | 2501718 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 47 | 5293324 | 5293536 | + | NZ_CP036298.1 | Aureliella helgolandensis |
| 48 | 3175744 | 3175962 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 49 | 1150025 | 1150255 | + | NZ_CP045851.1 | Actinomarinicola tropica |
| 50 | 2612721 | 2612945 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 51 | 1460861 | 1461091 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 52 | 1336589 | 1336786 | + | NZ_CP036299.1 | Planctopirus ephydatiae |
| 53 | 393769 | 393966 | + | NC_014148.1 | Planctopirus limnophila DSM 3776 |
| 54 | 661029 | 661256 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 55 | 262435 | 262656 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 56 | 3076541 | 3076765 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 57 | 2658041 | 2658268 | + | NZ_CP022983.1 | Cytobacillus kochii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011830.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00669.22 | 0.84 | 47 | 543.5 | same-strand | Bacterial flagellin N-terminal helical region |
| 2 | PF00700.23 | 0.77 | 43 | 547 | same-strand | Bacterial flagellin C-terminal helical region |
| 3 | PF02623.17 | 0.88 | 49 | 2.0 | same-strand | FliW protein |
| 4 | PF00460.22 | 0.62 | 35 | 2014.0 | same-strand | Flagella basal body rod protein |
| 5 | PF05130.14 | 0.7 | 39 | 3625.5 | same-strand | FlgN protein |
++ More..