Result : A0L5Z1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | CP000471.1 |
| Organism | Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) |
| Left | 1063824 |
| Right | 1064003 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGACATGATCAAAGTAAAGTTGGTACGGTCTTTTGTTGGGCGTCCTGATAAGCAGCGTCGGATTTGCGCTTCTTTGGGTTTGCACAAGATGAACCGTGTGAAGGAACTTCCCGACAACGCCGCCATCCGTGGTCAGATCAATAAGGTCTGTCACTTGGTAAGCGTGGTCGATTAA |
| Sequence | MADMIKVKLVRSFVGRPDKQRRICASLGLHKMNRVKELPDNAAIRGQINKVCHLVSVVD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 19465526 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A0L5Z1 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 182
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1063824 | 1064003 | + | NC_008576.1 | Magnetococcus marinus MC-1 |
| 2 | 644800 | 644979 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 3 | 1055275 | 1055454 | + | NZ_CP061800.1 | Desulfonema magnum |
| 4 | 149576 | 149758 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 5 | 186526 | 186702 | - | NZ_CP046314.1 | Gemella morbillorum |
| 6 | 1938123 | 1938305 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 7 | 139123 | 139305 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 8 | 1754743 | 1754919 | - | NZ_LR134484.1 | Gemella haemolysans |
| 9 | 8369531 | 8369719 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 10 | 4586069 | 4586257 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 11 | 1722090 | 1722269 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 12 | 1763148 | 1763327 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 13 | 2348032 | 2348202 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 14 | 1748359 | 1748541 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 15 | 1528423 | 1528575 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 16 | 668943 | 669095 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 17 | 1286618 | 1286797 | + | NZ_CP027770.1 | Staphylococcus felis |
| 18 | 330969 | 331148 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 19 | 258444 | 258626 | + | NZ_CP053989.1 | Niallia circulans |
| 20 | 712614 | 712793 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 21 | 6275615 | 6275791 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 22 | 246298 | 246477 | + | NZ_CP047361.1 | Macrococcus canis |
| 23 | 2946860 | 2947042 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 24 | 509591 | 509773 | + | NZ_CP030280.1 | Blautia argi |
| 25 | 145723 | 145905 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 26 | 4743980 | 4744162 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 27 | 776672 | 776851 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 28 | 1755707 | 1755895 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 29 | 1484503 | 1484685 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 30 | 117153 | 117335 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 31 | 1401569 | 1401751 | - | NZ_CP043404.1 | Bacillus safensis |
| 32 | 155208 | 155390 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 33 | 146889 | 147071 | + | NZ_CP012024.1 | Bacillus smithii |
| 34 | 154821 | 155003 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 35 | 340756 | 340938 | + | NZ_LN879430.1 | Herbinix luporum |
| 36 | 504687 | 504839 | - | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 37 | 1635173 | 1635361 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 38 | 297739 | 297921 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 39 | 2483645 | 2483824 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 40 | 777276 | 777428 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 41 | 136607 | 136789 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 42 | 312512 | 312691 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 43 | 133414 | 133566 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 44 | 1990619 | 1990798 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 45 | 5013225 | 5013377 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 46 | 2064749 | 2064928 | + | NC_018013.1 | Aequorivita sublithincola DSM 14238 |
| 47 | 1803867 | 1804043 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 48 | 394523 | 394702 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 49 | 1534228 | 1534410 | - | NC_015389.1 | Coriobacterium glomerans PW2 |
| 50 | 1418379 | 1418561 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 51 | 1561304 | 1561486 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 52 | 4569404 | 4569583 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 53 | 240417 | 240596 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 54 | 253554 | 253742 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 55 | 165037 | 165225 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 56 | 4838048 | 4838200 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 57 | 1973321 | 1973500 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 58 | 185636 | 185821 | + | NZ_CP061835.1 | Weissella viridescens |
| 59 | 3786525 | 3786704 | - | NZ_CP011937.1 | Bacillus velezensis |
| 60 | 279862 | 280041 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 61 | 143815 | 143994 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 62 | 144837 | 145016 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 63 | 143576 | 143755 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 64 | 143701 | 143880 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 65 | 113595 | 113774 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 66 | 1865648 | 1865827 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 67 | 143875 | 144054 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 68 | 141985 | 142164 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 69 | 150452 | 150634 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 70 | 2593878 | 2594057 | - | NZ_LR134483.1 | Listeria grayi |
| 71 | 5128647 | 5128823 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 72 | 108596 | 108781 | + | NZ_CP017326.1 | Weissella soli |
| 73 | 341987 | 342175 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 74 | 2944865 | 2945017 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 75 | 55719 | 55904 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 76 | 4175562 | 4175741 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 77 | 174465 | 174644 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 78 | 2859975 | 2860130 | - | NZ_CP029145.1 | Hymenobacter nivis |
| 79 | 1329245 | 1329439 | + | NZ_CP019044.1 | Salaquimonas pukyongi |
| 80 | 2350162 | 2350314 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 81 | 3090617 | 3090805 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 82 | 2531252 | 2531428 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 83 | 499940 | 500119 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 84 | 4438479 | 4438658 | + | NZ_CP019038.1 | Massilia putida |
| 85 | 652220 | 652396 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 86 | 565649 | 565828 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 87 | 253492 | 253674 | - | NZ_CP031124.1 | Ephemeroptericola cinctiostellae |
| 88 | 2456334 | 2456501 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 89 | 4395140 | 4395292 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 90 | 90340 | 90501 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 91 | 2194375 | 2194530 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 92 | 115255 | 115434 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 93 | 730042 | 730221 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 94 | 796735 | 796914 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 95 | 1394818 | 1395000 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 96 | 361016 | 361198 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 97 | 2829833 | 2830021 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 98 | 2259992 | 2260180 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 99 | 1570008 | 1570175 | - | NZ_CP012943.1 | Ralstonia solanacearum |
| 100 | 3371899 | 3372066 | - | NZ_CP016022.1 | Ralstonia insidiosa |
| 101 | 1560054 | 1560236 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 102 | 617658 | 617837 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 103 | 3615911 | 3616060 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 104 | 136181 | 136369 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 105 | 136966 | 137154 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 106 | 1835135 | 1835296 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 107 | 1311757 | 1311951 | + | NZ_CP024199.1 | Thalassospira marina |
| 108 | 1506293 | 1506475 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 109 | 2694997 | 2695176 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 110 | 2602841 | 2603020 | - | NZ_LT906444.1 | Listeria welshimeri |
| 111 | 1717187 | 1717348 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 112 | 1637440 | 1637625 | - | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 113 | 1633744 | 1633923 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 114 | 1972433 | 1972612 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 115 | 52852 | 53037 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 116 | 1467537 | 1467722 | + | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 117 | 346114 | 346296 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 118 | 341410 | 341592 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 119 | 344356 | 344538 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 120 | 903605 | 903760 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 121 | 2309398 | 2309577 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 122 | 1126814 | 1126999 | + | NZ_CP053015.1 | Sphingomonas lacunae |
| 123 | 2240329 | 2240508 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 124 | 1497263 | 1497445 | + | NZ_CP020121.1 | Comamonas kerstersii |
| 125 | 3990898 | 3991050 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 126 | 1853312 | 1853473 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 127 | 1515096 | 1515275 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 128 | 716328 | 716507 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 129 | 754667 | 754846 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 130 | 2163785 | 2163964 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 131 | 2265257 | 2265436 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 132 | 2592523 | 2592702 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 133 | 2718408 | 2718587 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 134 | 2697267 | 2697446 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 135 | 387160 | 387339 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 136 | 275023 | 275169 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 137 | 1404956 | 1405126 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 138 | 2274503 | 2274673 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 139 | 2795200 | 2795373 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 140 | 70590 | 70769 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 141 | 77697 | 77876 | + | NZ_CP065211.1 | Enterococcus lactis |
| 142 | 1777259 | 1777438 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 143 | 74995 | 75174 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 144 | 2174896 | 2175054 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 145 | 1313472 | 1313654 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 146 | 3627321 | 3627500 | - | NZ_CP033433.1 | Cohnella candidum |
| 147 | 581987 | 582166 | - | NZ_CP023011.2 | Enterococcus hirae |
| 148 | 3165955 | 3166134 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 149 | 590283 | 590462 | - | NC_020156.1 | Nonlabens dokdonensis DSW-6 |
| 150 | 1116809 | 1116991 | - | NZ_CP013355.1 | Lutibacter profundi |
| 151 | 84909 | 85067 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 152 | 1911496 | 1911675 | - | NC_015703.1 | Runella slithyformis DSM 19594 |
| 153 | 551255 | 551440 | + | NZ_CP014324.1 | Oenococcus oeni |
| 154 | 2360532 | 2360717 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 155 | 2218548 | 2218700 | + | NZ_CP020046.1 | Thiomonas intermedia |
| 156 | 1269202 | 1269390 | - | NZ_LT821227.1 | Phoenicibacter congonensis |
| 157 | 933948 | 934109 | + | NZ_LR134378.1 | Lautropia mirabilis |
| 158 | 2849797 | 2849973 | - | NZ_LT608328.1 | Petrimonas mucosa |
| 159 | 3852710 | 3852895 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 160 | 6081767 | 6081946 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 161 | 1259853 | 1260035 | + | NZ_CP064781.1 | Azospira restricta |
| 162 | 983702 | 983878 | - | NZ_CP007519.1 | Trueperella pyogenes |
| 163 | 3848978 | 3849127 | - | NC_015677.1 | Ramlibacter tataouinensis TTB310 |
| 164 | 4398382 | 4398573 | + | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 165 | 246478 | 246663 | + | NZ_AP019367.1 | Parolsenella catena |
| 166 | 677324 | 677485 | + | NZ_CP043405.1 | Streptococcus ratti |
| 167 | 1642829 | 1642981 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 168 | 2176836 | 2177018 | - | NZ_CP020822.1 | Tenacibaculum maritimum |
| 169 | 621015 | 621188 | - | NC_011666.1 | Methylocella silvestris BL2 |
| 170 | 114748 | 114933 | + | NZ_LT635455.1 | Olsenella timonensis |
| 171 | 796978 | 797163 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 172 | 826548 | 826730 | - | NZ_CP017774.1 | Flavobacterium commune |
| 173 | 2986718 | 2986900 | - | NC_016001.1 | Flavobacterium branchiophilum FL-15 |
| 174 | 3216972 | 3217148 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 175 | 171418 | 171600 | - | NZ_CP028811.1 | Flavobacterium magnum |
| 176 | 2055487 | 2055660 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 177 | 2669728 | 2669901 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 178 | 162931 | 163113 | - | NZ_CP029187.1 | Flavobacterium pallidum |
| 179 | 191633 | 191815 | - | NZ_CP017479.1 | Flavobacterium gilvum |
| 180 | 1730030 | 1730212 | + | NZ_CP020918.1 | Flavobacterium faecale |
| 181 | 1182854 | 1183036 | + | NZ_CP017688.1 | Flavobacterium crassostreae |
| 182 | 862883 | 863065 | - | NZ_CP054494.1 | Flavobacterium columnare |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP020773.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 0.86 | 157 | 1933 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00410.21 | 1.0 | 182 | 1503.0 | same-strand | Ribosomal protein S8 |
| 3 | PF00347.25 | 1.0 | 182 | 934.0 | same-strand | Ribosomal protein L6 |
| 4 | PF00861.24 | 0.99 | 180 | 540.0 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 5 | PF03719.17 | 1.0 | 182 | 15.0 | same-strand | Ribosomal protein S5, C-terminal domain |
| 6 | PF00333.22 | 1.0 | 182 | 15.0 | same-strand | Ribosomal protein S5, N-terminal domain |
| 7 | PF00828.21 | 0.99 | 181 | 31 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 8 | PF00344.22 | 1.0 | 182 | 473.0 | same-strand | SecY |
| 9 | PF01176.21 | 0.7 | 127 | 2658 | same-strand | Translation initiation factor 1A / IF-1 |
| 10 | PF00406.24 | 0.79 | 144 | 1823.0 | same-strand | Adenylate kinase |
| 11 | PF13207.8 | 0.79 | 144 | 1823.0 | same-strand | AAA domain |
| 12 | PF05191.16 | 0.69 | 126 | 1823.0 | same-strand | Adenylate kinase, active site lid |
| 13 | PF13671.8 | 0.67 | 122 | 1821.5 | same-strand | AAA domain |
++ More..