Result : Q21QM3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | CP000267.1 |
| Organism | Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) (Albidiferax ferrireducens) |
| Left | 4711150 |
| Right | 4711434 |
| Strand | - |
| Nucleotide Sequence | ATGATCAGGGACGTGCTGGTCGGCATAGTCAAGGGCTACCGCTTGCTGTTGAGTCCTTGGCTGGGTTCGTCCTGCCGATTTGAGCCGACTTGTTCTGCCTATTCCCTGCAGGCCTTGCAAACGCATGGCGCGGCAGCGGGCAGTTATCTGACGTTGACGAGACTCGCACGTTGTCATCCCTGGTGCGCGGGCGGTTCCGATCCGGTTCCGAGTGAAAAACCCCGATTCAAATCCCAGTTGTTTACCCAACTGATTCACCCTTCCTCTGAAAAGAAGTCTTCATGA |
| Sequence | MIRDVLVGIVKGYRLLLSPWLGSSCRFEPTCSAYSLQALQTHGAAAGSYLTLTRLARCHPWCAGGSDPVPSEKPRFKSQLFTQLIHPSSEKKSS |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | Q21QM3 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4711150 | 4711434 | - | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 2 | 5799230 | 5799502 | - | NZ_CP019236.1 | Rhodoferax koreense |
| 3 | 4263774 | 4264046 | - | NZ_CP019239.1 | Rhodoferax saidenbachensis |
| 4 | 3985642 | 3985935 | - | NZ_CP021359.1 | Acidovorax carolinensis |
| 5 | 2405 | 2710 | + | NZ_CP035503.1 | Rhodoferax sediminis |
| 6 | 3327290 | 3327583 | + | NZ_CP060790.1 | Acidovorax monticola |
| 7 | 3246272 | 3246568 | + | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 8 | 4661560 | 4661850 | - | NZ_CP065748.1 | Delftia lacustris |
| 9 | 4703229 | 4703519 | - | NZ_CP017420.1 | Delftia tsuruhatensis |
| 10 | 1605795 | 1606091 | + | NZ_CP027669.1 | Simplicispira suum |
| 11 | 4706023 | 4706316 | - | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 12 | 2463 | 2750 | + | NZ_CP054840.1 | Acidovorax antarcticus |
| 13 | 4617522 | 4617791 | + | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 14 | 136728 | 137024 | + | NZ_CP027792.1 | Pulveribacter suum |
| 15 | 1315583 | 1315855 | + | NZ_CP020121.1 | Comamonas kerstersii |
| 16 | 2973038 | 2973289 | - | NZ_CP060783.1 | Diaphorobacter aerolatus |
| 17 | 826662 | 826946 | + | NZ_CP043575.1 | Comamonas koreensis |
| 18 | 4859641 | 4859871 | - | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 19 | 4069224 | 4069499 | - | NC_015677.1 | Ramlibacter tataouinensis TTB310 |
| 20 | 3915123 | 3915407 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
| 21 | 4907996 | 4908280 | - | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 22 | 5565844 | 5566149 | - | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 23 | 4942920 | 4943150 | - | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 24 | 2821732 | 2821980 | - | NZ_CP047650.1 | Xylophilus rhododendri |
| 25 | 2572861 | 2573109 | - | NZ_AP014568.1 | Serpentinomonas raichei |
| 26 | 970996 | 971280 | - | NZ_CP027666.1 | Ottowia oryzae |
| 27 | 6396931 | 6397164 | - | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 28 | 3857265 | 3857576 | - | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 29 | 3836326 | 3836577 | - | NZ_CP051461.1 | Polaromonas vacuolata |
| 30 | 3888484 | 3888729 | - | NZ_CP029210.1 | Aquabacterium olei |
| 31 | 46901 | 47170 | - | NZ_CP021455.1 | Comamonas serinivorans |
| 32 | 4401148 | 4401426 | - | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 33 | 2605431 | 2605679 | - | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 34 | 4083281 | 4083517 | - | NZ_CP040709.1 | Inhella inkyongensis |
| 35 | 2391534 | 2391767 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 36 | 36376 | 36636 | - | NZ_CP024608.1 | Massilia violaceinigra |
| 37 | 368201 | 368437 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
| 38 | 1904787 | 1905017 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 39 | 5680378 | 5680662 | - | NZ_CP013729.1 | Roseateles depolymerans |
| 40 | 6336367 | 6336615 | - | NZ_CP028324.1 | Massilia armeniaca |
| 41 | 1637493 | 1637732 | - | NC_016043.1 | Taylorella asinigenitalis MCE3 |
| 42 | 1482414 | 1482647 | + | NZ_AP019735.1 | Alistipes communis |
| 43 | 2461902 | 2462138 | - | NZ_LN831026.1 | Corynebacterium diphtheriae |
| 44 | 2449257 | 2449493 | - | NZ_LR738855.1 | Corynebacterium rouxii |
| 45 | 2923999 | 2924238 | - | NZ_CP009245.1 | Corynebacterium aquilae DSM 44791 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007908.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12631.9 | 0.71 | 32 | 1818.0 | same-strand | MnmE helical domain |
| 2 | PF10396.11 | 0.71 | 32 | 1818.0 | same-strand | GTP-binding protein TrmE N-terminus |
| 3 | PF01926.25 | 0.78 | 35 | 1861 | same-strand | 50S ribosome-binding GTPase |
| 4 | PF14849.8 | 0.91 | 41 | -3 | same-strand | YidC periplasmic domain |
| 5 | PF02096.22 | 0.98 | 44 | -3.0 | same-strand | 60Kd inner membrane protein |
| 6 | PF00468.19 | 0.91 | 41 | 534 | same-strand | Ribosomal protein L34 |
++ More..