Result : Q21LC1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein FtsB |
| NCBI Accession ID | CP000282.1 |
| Organism | Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) |
| Left | 1597645 |
| Right | 1597947 |
| Strand | + |
| Nucleotide Sequence | ATGAAGTGGCTCGCCATTATTTTAGTTGTTGCGCTTTTAGCTCTCCAGTATAGGCTGTGGATGGGCGAGGGTAGTATTGCCAGCGTGGTGAGTTTAAATAGAGAAATTGCCAAGCAGAAAGAAGAAAACGCGCGCCTGCGTGAACGCAACAGATTACTAGCAGCCGAAGTGGATGCATTGAAGCAAGGCAAAGATGCTATAGAAGAAAGAGCCCGCAACGACATGGGCATGATAAAAGAAGGCGAAACATTTTTTATGATTGTGGACGAAACAGACAAAGACACGAAAAAAAATAAAAAATGA |
| Sequence | MKWLAIILVVALLALQYRLWMGEGSIASVVSLNREIAKQKEENARLRERNRLLAAEVDALKQGKDAIEERARNDMGMIKEGETFFMIVDETDKDTKKNKK |
| Source of smORF | Swiss-Prot |
| Function | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. {ECO:0000255|HAMAP-Rule:MF_00599}. |
| Pubmed ID | 18516288 |
| Domain | CDD:416267 |
| Functional Category | Others |
| Uniprot ID | Q21LC1 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 66
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1597645 | 1597947 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 2 | 799433 | 799717 | + | NZ_CP060084.1 | Teredinibacter haidensis |
| 3 | 2531229 | 2531516 | + | NZ_CP060092.1 | Teredinibacter purpureus |
| 4 | 1210288 | 1210566 | + | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 5 | 4706872 | 4707132 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 6 | 1096230 | 1096523 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 7 | 157376 | 157663 | - | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 8 | 4722905 | 4723165 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 9 | 2558827 | 2559108 | - | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 10 | 3646014 | 3646265 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 11 | 1783299 | 1783547 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 12 | 285063 | 285347 | - | NC_017856.1 | Methylophaga frappieri |
| 13 | 2512949 | 2513242 | - | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 14 | 1344270 | 1344584 | + | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 15 | 1445533 | 1445826 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 16 | 4326396 | 4326695 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
| 17 | 1302743 | 1302994 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 18 | 5377196 | 5377447 | - | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 19 | 603909 | 604160 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 20 | 3451860 | 3452159 | - | NZ_CP022358.1 | Shewanella bicestrii |
| 21 | 4068328 | 4068579 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 22 | 2340158 | 2340448 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 23 | 3324050 | 3324301 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 24 | 2009213 | 2009464 | + | NZ_CP060009.1 | Pseudomonas sediminis |
| 25 | 909375 | 909689 | + | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 26 | 1378585 | 1378881 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 27 | 3807126 | 3807425 | - | NC_016901.1 | Shewanella baltica OS678 |
| 28 | 3512629 | 3512871 | + | NC_015554.1 | Alteromonas naphthalenivorans |
| 29 | 1038818 | 1039075 | - | NZ_CP022684.1 | Ketobacter alkanivorans |
| 30 | 455058 | 455360 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 31 | 636379 | 636621 | - | NZ_CP014322.1 | Alteromonas addita |
| 32 | 2408922 | 2409194 | - | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 33 | 3045572 | 3045916 | - | NZ_CP041046.1 | Luteibacter pinisoli |
| 34 | 1556677 | 1556976 | - | NZ_CP034759.1 | Litorilituus sediminis |
| 35 | 1546171 | 1546488 | - | NZ_AP014879.1 | Sulfuricaulis limicola |
| 36 | 1808723 | 1809037 | - | NZ_AP012273.1 | Thiolapillus brandeum |
| 37 | 3065590 | 3065874 | - | NZ_CP021435.1 | Halomonas beimenensis |
| 38 | 28566 | 28910 | - | NZ_CP017480.1 | Luteibacter rhizovicinus DSM 16549 |
| 39 | 1644825 | 1645073 | - | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 40 | 3921044 | 3921331 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 41 | 1552332 | 1552601 | + | NZ_CP013189.1 | Pseudohongiella spirulinae |
| 42 | 2672754 | 2673056 | - | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 43 | 1756925 | 1757197 | - | NZ_CP017715.1 | Marinobacter salinus |
| 44 | 816849 | 817148 | + | NZ_CP025120.1 | Kangiella profundi |
| 45 | 1205340 | 1205615 | + | NZ_CP046603.1 | Lysobacter soli |
| 46 | 1697238 | 1697567 | - | NC_012968.1 | Methylotenera mobilis JLW8 |
| 47 | 1391660 | 1391911 | + | NZ_CP052766.1 | Alteromonas pelagimontana |
| 48 | 4051861 | 4052112 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 49 | 1678815 | 1679090 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 50 | 1337351 | 1337623 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 51 | 1626449 | 1626763 | + | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 52 | 1860195 | 1860488 | - | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 53 | 592101 | 592343 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 54 | 1714822 | 1715064 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 55 | 515514 | 515774 | - | NZ_CP046670.1 | Alteromonas mediterranea |
| 56 | 1278970 | 1279257 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 57 | 2045577 | 2045858 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 58 | 1654222 | 1654497 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 59 | 1700145 | 1700417 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 60 | 687872 | 688129 | + | NZ_CP015839.1 | Marinobacterium aestuarii |
| 61 | 512301 | 512561 | - | NZ_CP031769.1 | Salinimonas sediminis |
| 62 | 2096344 | 2096631 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 63 | 1477016 | 1477327 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 64 | 526122 | 526400 | - | NZ_CP029347.1 | Saliniradius amylolyticus |
| 65 | 1899902 | 1900213 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 66 | 1203734 | 1204018 | + | NZ_CP031415.1 | Saccharospirillum mangrovi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007912.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06418.16 | 0.82 | 54 | 2364.0 | same-strand | CTP synthase N-terminus |
| 2 | PF00117.30 | 0.82 | 54 | 2365 | same-strand | Glutamine amidotransferase class-I |
| 3 | PF00793.22 | 0.71 | 47 | 1508 | same-strand | DAHP synthetase I family |
| 4 | PF00113.24 | 0.82 | 54 | 100.5 | same-strand | Enolase, C-terminal TIM barrel domain |
| 5 | PF03952.18 | 0.82 | 54 | 100.5 | same-strand | Enolase, N-terminal domain |
| 6 | PF01128.21 | 0.89 | 59 | -3 | same-strand | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
| 7 | PF02542.18 | 0.71 | 47 | 745 | same-strand | YgbB family |
++ More..