Result : Q21L28

Protein Information

• Protein name: YcgL domain-containing protein Sde_1339
• NCBI Accession ID: CP000282.1
• Organism: Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
• Left: 1734834
• Right: 1735109
• Strand: +
• Nucleotide Sequence: TTGATAGTTGATATTTACCGCAGCGCTAAAAAAGAAGGCATGTATTTGTATGTGCCTAGAAATAAAGCGCTAGATGAGTTGCCCGAGCCGCTAATGAAGCAATTTGGCCGCGCCGATCATTCTATGGTGCTGGTGTTAACGCCAGAGAAAAAGCTTGCGCGTGCAAGTGTAGAAAAAGTTATCGAGTCTATAGAAAACCAAGGGTTCTATTTGCAAATGCCTCCGCCGCCAGAGAGCTATATGAACGAAATCCCCAACGATAAAATGCCGCGCTAA
• Sequence: MIVDIYRSAKKEGMYLYVPRNKALDELPEPLMKQFGRADHSMVLVLTPEKKLARASVEKVIESIENQGFYLQMPPPPESYMNEIPNDKMPR
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure.
• Pubmed ID: 18516288
• Domain: CDD:419850
• Functional Category: Others
• Uniprot ID: Q21L28
• ORF Length (Amino Acid): 91

Conservation Analysis

No. of Species: 28

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1734834	1735109	+	NC_007912.1	Saccharophagus degradans 2-40
2	2359076	2359309	+	NZ_CP020038.1	Agarilytica rhodophyticola
3	1016636	1016923	+	NZ_CP060084.1	Teredinibacter haidensis
4	2796376	2796612	+	NZ_CP060092.1	Teredinibacter purpureus
5	2257400	2257642	-	NZ_CP031093.1	Hydrocarboniclastica marina
6	4400204	4400440	-	NZ_CP014205.2	Pseudomonas glycinae
7	1629075	1629311	+	NZ_CP062253.1	Pseudomonas gozinkensis
8	1652898	1653134	+	NZ_CP029608.1	Pseudomonas kribbensis
9	2437424	2437651	-	NZ_CP036422.1	Halioglobus maricola
10	2014559	2014849	-	NC_008260.1	Alcanivorax borkumensis SK2
11	4035666	4035890	-	NZ_CP019343.1	Oceanicoccus sagamiensis
12	3804792	3805028	+	NZ_CP070273.1	Marinomonas foliarum
13	4041785	4042033	-	NZ_AP014862.1	Pseudomonas furukawaii
14	4214879	4215127	-	NZ_CP047698.1	Pseudomonas knackmussii
15	136589	136831	-	NZ_CP014143.1	Microbulbifer aggregans
16	4998628	4998876	-	NZ_CP014158.1	Pseudomonas citronellolis
17	1749246	1749479	+	NZ_CP014544.1	Zhongshania aliphaticivorans
18	2053154	2053378	-	NZ_CP031415.1	Saccharospirillum mangrovi
19	2437328	2437585	-	NZ_CP034036.1	Brenneria nigrifluens DSM 30175 = ATCC 13028
20	2405853	2406092	-	NZ_CP004387.1	Alcanivorax pacificus W11-5
21	2414755	2415027	-	NZ_CP072455.1	Xenorhabdus budapestensis
22	1509005	1509232	-	NC_021883.1	Mannheimia haemolytica USMARC_2286
23	2506056	2506313	-	NZ_CP051652.1	Pectobacterium carotovorum
24	3874715	3874972	+	NZ_CP047495.1	Pectobacterium brasiliense
25	2350063	2350320	+	NZ_CP065044.1	Pectobacterium aroidearum
26	4072265	4072522	+	NZ_CP015750.1	Pectobacterium wasabiae CFBP 3304
27	2282883	2283140	+	NZ_CP038498.1	Pectobacterium punjabense
28	1365047	1365352	+	NZ_CP044483.1	Acinetobacter schindleri

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_007912.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01612.22	0.96	27	58	same-strand	3'-5' exonuclease
2	PF00570.25	0.96	27	58	same-strand	HRDC domain
3	PF03692.17	0.93	26	529.0	same-strand	Putative zinc- or iron-chelating domain