Protein Information |
Information Type | Description |
---|---|
Protein name | YcgL domain-containing protein Sde_1339 |
NCBI Accession ID | CP000282.1 |
Organism | Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) |
Left | 1734834 |
Right | 1735109 |
Strand | + |
Nucleotide Sequence | TTGATAGTTGATATTTACCGCAGCGCTAAAAAAGAAGGCATGTATTTGTATGTGCCTAGAAATAAAGCGCTAGATGAGTTGCCCGAGCCGCTAATGAAGCAATTTGGCCGCGCCGATCATTCTATGGTGCTGGTGTTAACGCCAGAGAAAAAGCTTGCGCGTGCAAGTGTAGAAAAAGTTATCGAGTCTATAGAAAACCAAGGGTTCTATTTGCAAATGCCTCCGCCGCCAGAGAGCTATATGAACGAAATCCCCAACGATAAAATGCCGCGCTAA |
Sequence | MIVDIYRSAKKEGMYLYVPRNKALDELPEPLMKQFGRADHSMVLVLTPEKKLARASVEKVIESIENQGFYLQMPPPPESYMNEIPNDKMPR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
Pubmed ID | 18516288 |
Domain | CDD:419850 |
Functional Category | Others |
Uniprot ID | Q21L28 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1734834 | 1735109 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
2 | 2359076 | 2359309 | + | NZ_CP020038.1 | Agarilytica rhodophyticola |
3 | 1016636 | 1016923 | + | NZ_CP060084.1 | Teredinibacter haidensis |
4 | 2796376 | 2796612 | + | NZ_CP060092.1 | Teredinibacter purpureus |
5 | 2257400 | 2257642 | - | NZ_CP031093.1 | Hydrocarboniclastica marina |
6 | 4400204 | 4400440 | - | NZ_CP014205.2 | Pseudomonas glycinae |
7 | 1629075 | 1629311 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
8 | 1652898 | 1653134 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
9 | 2437424 | 2437651 | - | NZ_CP036422.1 | Halioglobus maricola |
10 | 2014559 | 2014849 | - | NC_008260.1 | Alcanivorax borkumensis SK2 |
11 | 4035666 | 4035890 | - | NZ_CP019343.1 | Oceanicoccus sagamiensis |
12 | 3804792 | 3805028 | + | NZ_CP070273.1 | Marinomonas foliarum |
13 | 4041785 | 4042033 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
14 | 4214879 | 4215127 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
15 | 136589 | 136831 | - | NZ_CP014143.1 | Microbulbifer aggregans |
16 | 4998628 | 4998876 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
17 | 1749246 | 1749479 | + | NZ_CP014544.1 | Zhongshania aliphaticivorans |
18 | 2053154 | 2053378 | - | NZ_CP031415.1 | Saccharospirillum mangrovi |
19 | 2437328 | 2437585 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
20 | 2405853 | 2406092 | - | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
21 | 2414755 | 2415027 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
22 | 1509005 | 1509232 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
23 | 2506056 | 2506313 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
24 | 3874715 | 3874972 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
25 | 2350063 | 2350320 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
26 | 4072265 | 4072522 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
27 | 2282883 | 2283140 | + | NZ_CP038498.1 | Pectobacterium punjabense |
28 | 1365047 | 1365352 | + | NZ_CP044483.1 | Acinetobacter schindleri |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01612.22 | 0.96 | 27 | 58 | same-strand | 3'-5' exonuclease |
2 | PF00570.25 | 0.96 | 27 | 58 | same-strand | HRDC domain |
3 | PF03692.17 | 0.93 | 26 | 529.0 | same-strand | Putative zinc- or iron-chelating domain |