Result : Q21FZ9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000282.1 |
| Organism | Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) |
| Left | 3997367 |
| Right | 3997636 |
| Strand | - |
| Nucleotide Sequence | ATGCAAACGACTCGTTACCGCGTGGAAGGCAAGGTGCAAGGGGTATATTTTCGTGCGAGCACCCAGAGGGAGGCGCAAGCGCAGGGGTTAACTGGCTGGGTATGTAATTGTGAAGACGGGGCTGTTGAGCTAGTCGCTACCGGAACAGCGCAGCAGCATGCGAAATTAGCCGCGTGGTTAGCCTGCGGGCCGCCAATGGCAAGAGTGGATAGGGTAATACAAACAGATGAGCCGTTAGTGCTATTCGATGGATTCGACATCCATTACTAA |
| Sequence | MQTTRYRVEGKVQGVYFRASTQREAQAQGLTGWVCNCEDGAVELVATGTAQQHAKLAAWLACGPPMARVDRVIQTDEPLVLFDGFDIHY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 18516288 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q21FZ9 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 67
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3997367 | 3997636 | - | NC_007912.1 | Saccharophagus degradans 2-40 |
| 2 | 4254779 | 4255048 | - | NZ_CP011131.1 | Lysobacter gummosus |
| 3 | 1143392 | 1143670 | + | NZ_LT615367.1 | Dickeya aquatica |
| 4 | 3512535 | 3512777 | + | NZ_CP007230.1 | Yersinia similis |
| 5 | 505687 | 505914 | + | NZ_CP012154.1 | Wenzhouxiangella marina |
| 6 | 961547 | 961789 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 7 | 3175259 | 3175510 | - | NZ_CP071320.1 | Serratia ureilytica |
| 8 | 3322215 | 3322448 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 9 | 2728329 | 2728598 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 10 | 1660075 | 1660356 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 11 | 3807954 | 3808187 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 12 | 830440 | 830685 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 13 | 4187143 | 4187424 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 14 | 3573773 | 3574006 | - | NZ_CP054254.1 | Klebsiella variicola |
| 15 | 4536376 | 4536645 | - | NZ_CP011129.1 | Lysobacter antibioticus |
| 16 | 1645545 | 1645778 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 17 | 1625262 | 1625495 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 18 | 3326055 | 3326318 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 19 | 1948278 | 1948511 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 20 | 3429174 | 3429416 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 21 | 1759587 | 1759829 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 22 | 903517 | 903750 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 23 | 1173562 | 1173843 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 24 | 1686316 | 1686597 | - | NZ_CP038469.1 | Citrobacter tructae |
| 25 | 380841 | 381059 | - | NZ_CP027792.1 | Pulveribacter suum |
| 26 | 3562030 | 3562311 | + | NZ_CP053416.1 | Salmonella bongori |
| 27 | 1857048 | 1857329 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 28 | 1938801 | 1939082 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 29 | 1614331 | 1614564 | + | NC_015968.1 | Enterobacter soli |
| 30 | 3364302 | 3364535 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 31 | 550970 | 551251 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 32 | 2188470 | 2188700 | - | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 33 | 2633115 | 2633351 | - | NZ_CP024935.1 | Paraburkholderia graminis |
| 34 | 1141451 | 1141684 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 35 | 3137945 | 3138226 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 36 | 2935517 | 2935780 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 37 | 456508 | 456783 | + | NZ_LN999010.1 | Thermococcus chitonophagus |
| 38 | 1669466 | 1669699 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 39 | 2996337 | 2996570 | - | NZ_LR134201.1 | Cedecea lapagei |
| 40 | 3714454 | 3714717 | - | NZ_CP050508.1 | Raoultella terrigena |
| 41 | 4531101 | 4531382 | + | NZ_CP033744.1 | Citrobacter freundii |
| 42 | 4464669 | 4464938 | - | NZ_CP023465.1 | Lysobacter capsici |
| 43 | 1210855 | 1211130 | + | NC_015680.1 | Pyrococcus yayanosii CH1 |
| 44 | 1813138 | 1813383 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 45 | 1333980 | 1334222 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 46 | 174596 | 174871 | - | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 47 | 1244953 | 1245195 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 48 | 3952425 | 3952688 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 49 | 1757034 | 1757258 | - | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 50 | 2876228 | 2876509 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 51 | 1328625 | 1328852 | - | NZ_CP049135.1 | Paraburkholderia tropica |
| 52 | 2854790 | 2855032 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 53 | 2061977 | 2062204 | + | NZ_CP046910.1 | Paraburkholderia acidiphila |
| 54 | 1732422 | 1732664 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 55 | 3648454 | 3648687 | + | NZ_CP026047.1 | Raoultella planticola |
| 56 | 3596288 | 3596521 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 57 | 3766649 | 3766912 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 58 | 1742350 | 1742631 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 59 | 2616245 | 2616514 | - | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 60 | 3426334 | 3426588 | - | NZ_CP041247.1 | Raoultella electrica |
| 61 | 4219586 | 4219825 | - | NZ_CP019706.1 | Pantoea alhagi |
| 62 | 4637452 | 4637688 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 63 | 1632619 | 1632858 | + | NZ_CP061511.1 | Mixta calida |
| 64 | 785987 | 786220 | - | NZ_CP025227.1 | Actinomyces wuliandei |
| 65 | 1899074 | 1899322 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 66 | 1143246 | 1143512 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 67 | 860590 | 860856 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP071320.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13380.8 | 0.63 | 42 | 1781.5 | same-strand | CoA binding domain |
| 2 | PF02629.21 | 0.61 | 41 | 1784 | same-strand | CoA binding domain |
| 3 | PF08755.13 | 0.66 | 44 | 1431.5 | opposite-strand | Hemimethylated DNA-binding protein YccV like |
| 4 | PF04358.15 | 0.69 | 46 | -3.0 | opposite-strand | DsrC like protein |
| 5 | PF17785.3 | 0.66 | 44 | 224.5 | opposite-strand | PUA-like domain |
++ More..