Result : Q1WUK1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000233.1 |
| Organism | Lactobacillus salivarius (strain UCC118) |
| Left | 570979 |
| Right | 571251 |
| Strand | - |
| Nucleotide Sequence | TTGAAAAATTATAAGATTATTGTTTTCGGTACCGTCCAAGGTGTTGGATTCCGTTATACAACTAAAGCTATCGCTGATAATATGGGTATTAAGGGAATCGTACGTAATCAAAGCGATGGAACTGTTTATATTGAAGCACAAGGAAATAGTTTATTACTATCGCAATTCATATCTTCTATAAAAGCTCCCAAAAATCCATTTGCTAAAGTTACAAAAATTGATGTTTCAGAAATTCCTGTAAAAACATATAATGACTTTTCTGTAACTTATTAG |
| Sequence | MKNYKIIVFGTVQGVGFRYTTKAIADNMGIKGIVRNQSDGTVYIEAQGNSLLLSQFISSIKAPKNPFAKVTKIDVSEIPVKTYNDFSVTY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 16617113 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q1WUK1 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 564881 | 565153 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 2 | 1433267 | 1433539 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 3 | 1771005 | 1771280 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 4 | 1990167 | 1990406 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 5 | 1796750 | 1796989 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 6 | 2536161 | 2536436 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 7 | 2028387 | 2028662 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 8 | 1811972 | 1812247 | + | NZ_CP012024.1 | Bacillus smithii |
| 9 | 1331329 | 1331589 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011403.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02096.22 | 0.67 | 6 | 104.0 | same-strand | 60Kd inner membrane protein |
++ More..