Result : Q1WUB4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000233.1 |
| Organism | Lactobacillus salivarius (strain UCC118) |
| Left | 652224 |
| Right | 652421 |
| Strand | + |
| Nucleotide Sequence | ATGATTTTATACCCATCAGTAGATGATTTATTAGAACAAGTTGATTCTAGATATTCTTTAATTATGTTAGCTGCTAAGCGTGCACACGATTTAGATGCTGGTTCCCCAGAATTATTATCCAACTATGAATCACCAAAAAATATTGGACATGCATTAGAAGAAATAGCTGCTGGTAAAGTTAAAATTAAGGAAGACTAA |
| Sequence | MILYPSVDDLLEQVDSRYSLIMLAAKRAHDLDAGSPELLSNYESPKNIGHALEEIAAGKVKIKED |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 16617113 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q1WUB4 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 87
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 643823 | 644020 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 2 | 2911452 | 2911664 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 3 | 1071605 | 1071820 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 4 | 2006904 | 2007125 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 5 | 708964 | 709167 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 6 | 2957530 | 2957745 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 7 | 830870 | 831079 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 8 | 1688185 | 1688397 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 9 | 828100 | 828309 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 10 | 1881398 | 1881607 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 11 | 719827 | 720036 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 12 | 1527400 | 1527612 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 13 | 1060981 | 1061190 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 14 | 870969 | 871178 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 15 | 2137295 | 2137510 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 16 | 1071101 | 1071313 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 17 | 1098891 | 1099109 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 18 | 1014165 | 1014380 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 19 | 2125078 | 2125290 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 20 | 1770032 | 1770244 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 21 | 1811839 | 1812051 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 22 | 1269304 | 1269522 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 23 | 2344654 | 2344866 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 24 | 869591 | 869791 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 25 | 731371 | 731589 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 26 | 646783 | 646986 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 27 | 1149527 | 1149712 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 28 | 995068 | 995244 | - | NZ_CP029476.1 | Lactobacillus apis |
| 29 | 646918 | 647112 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 30 | 141085 | 141297 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 31 | 1160301 | 1160519 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 32 | 795958 | 796182 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 33 | 1233344 | 1233529 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 34 | 2454616 | 2454816 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 35 | 1113008 | 1113208 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 36 | 1209239 | 1209460 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 37 | 1049454 | 1049672 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 38 | 1210519 | 1210719 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 39 | 717217 | 717435 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 40 | 736134 | 736310 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 41 | 729919 | 730107 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 42 | 850599 | 850793 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 43 | 1303284 | 1303475 | - | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 44 | 1086548 | 1086739 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 45 | 610721 | 610951 | + | NZ_CP027563.1 | Weissella confusa |
| 46 | 512826 | 513020 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 47 | 1366257 | 1366469 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 48 | 1124450 | 1124662 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 49 | 67343 | 67555 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 50 | 1648921 | 1649133 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 51 | 285372 | 285575 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 52 | 499737 | 499952 | + | NZ_CP061835.1 | Weissella viridescens |
| 53 | 552130 | 552330 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 54 | 599213 | 599416 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 55 | 1286277 | 1286489 | - | NZ_CP042410.1 | Leuconostoc citreum |
| 56 | 1542222 | 1542425 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 57 | 1450512 | 1450724 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 58 | 1953818 | 1954024 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 59 | 475247 | 475471 | + | NZ_CP014161.1 | Aerococcus urinae |
| 60 | 82363 | 82560 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 61 | 1702325 | 1702537 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 62 | 107318 | 107524 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 63 | 1746233 | 1746448 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 64 | 1581718 | 1581930 | - | NZ_CP014164.1 | Aerococcus viridans |
| 65 | 323663 | 323875 | - | NZ_CP014159.1 | Aerococcus christensenii |
| 66 | 624987 | 625199 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 67 | 1230464 | 1230649 | - | NZ_CP017326.1 | Weissella soli |
| 68 | 1071196 | 1071402 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 69 | 1860455 | 1860661 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 70 | 1956270 | 1956476 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 71 | 1394820 | 1395017 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 72 | 1287952 | 1288149 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 73 | 2603749 | 2603958 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 74 | 1875917 | 1876123 | - | NZ_LT906444.1 | Listeria welshimeri |
| 75 | 2301174 | 2301407 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 76 | 1322000 | 1322227 | + | NZ_CP012024.1 | Bacillus smithii |
| 77 | 1403551 | 1403742 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 78 | 157865 | 158077 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 79 | 2299812 | 2299985 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 80 | 1172278 | 1172445 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 81 | 1462649 | 1462861 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 82 | 1476509 | 1476721 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 83 | 1350957 | 1351169 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 84 | 1344722 | 1344934 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 85 | 567442 | 567642 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 86 | 2219484 | 2219690 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 87 | 2671222 | 2671422 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011403.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00625.23 | 0.99 | 86 | 2.0 | same-strand | Guanylate kinase |
| 2 | PF17764.3 | 0.8 | 70 | 1313.0 | same-strand | 3'DNA-binding domain (3'BD) |
| 3 | PF18074.3 | 0.8 | 70 | 1313.0 | same-strand | Primosomal protein N C-terminal domain |
| 4 | PF04851.17 | 0.8 | 70 | 1313.0 | same-strand | Type III restriction enzyme, res subunit |
| 5 | PF00270.31 | 0.8 | 70 | 1313.0 | same-strand | DEAD/DEAH box helicase |
| 6 | PF18319.3 | 0.8 | 70 | 1313.0 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 7 | PF00551.21 | 0.8 | 70 | 3763.0 | same-strand | Formyl transferase |
| 8 | PF02911.20 | 0.8 | 70 | 3763.0 | same-strand | Formyl transferase, C-terminal domain |
| 9 | PF01189.19 | 0.75 | 65 | 4702 | same-strand | 16S rRNA methyltransferase RsmB/F |
| 10 | PF01029.20 | 0.75 | 65 | 4698 | same-strand | NusB family |
++ More..