Result : Q1WT35
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0473 protein LSL_1108 |
| NCBI Accession ID | CP000233.1 |
| Organism | Lactobacillus salivarius (strain UCC118) |
| Left | 1135794 |
| Right | 1136090 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAAACAGAATCAAGATGAAAACTTAATTACATTAGTTGACGAACAAGGAAATGAAACTTTATACCAAGAATTGTTCAATTTCCATTCAGATGACTATGACAAATCATATATTTTATTGATTCCGGCAGGTTCAGAACCTGAAGAACAAGTAGATGTGTTGGCATTCGCATTCAATCCAGATGAAAACGATGATAGCCAGGATTATGAATTGTTTGATATTGAAAGTGATGAAGAATGGGAAATGGTAGAAGGTGTCCTAGATACTTTCTTGAACGATGAAAATATGAGATAA |
| Sequence | MAKQNQDENLITLVDEQGNETLYQELFNFHSDDYDKSYILLIPAGSEPEEQVDVLAFAFNPDENDDSQDYELFDIESDEEWEMVEGVLDTFLNDENMR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
| Pubmed ID | 16617113 |
| Domain | CDD:412983 |
| Functional Category | Others |
| Uniprot ID | Q1WT35 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 60
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1093506 | 1093802 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 2 | 629052 | 629321 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 3 | 631920 | 632186 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 4 | 1457953 | 1458282 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 5 | 644939 | 645238 | + | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 6 | 1388735 | 1389031 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 7 | 1174053 | 1174352 | - | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 8 | 520323 | 520622 | + | NZ_CP015247.1 | Leuconostoc suionicum |
| 9 | 454753 | 455019 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 10 | 447372 | 447638 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 11 | 336335 | 336640 | + | NZ_CP029476.1 | Lactobacillus apis |
| 12 | 1847017 | 1847328 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 13 | 1197085 | 1197396 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 14 | 509931 | 510227 | - | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 15 | 1427628 | 1427924 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 16 | 515143 | 515382 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 17 | 396777 | 397043 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 18 | 1353865 | 1354146 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 19 | 1487397 | 1487708 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 20 | 1426437 | 1426676 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 21 | 465199 | 465465 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 22 | 1246542 | 1246829 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 23 | 352727 | 352993 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 24 | 1953577 | 1953885 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 25 | 293487 | 293753 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 26 | 736406 | 736648 | + | NC_014334.2 | Lacticaseibacillus paracasei |
| 27 | 1422929 | 1423243 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 28 | 1887584 | 1887901 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 29 | 706468 | 706788 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 30 | 597374 | 597694 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 31 | 1265879 | 1266196 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 32 | 744938 | 745177 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 33 | 1376580 | 1376858 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 34 | 1194385 | 1194720 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 35 | 468358 | 468597 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 36 | 585304 | 585606 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 37 | 608804 | 609100 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 38 | 1477430 | 1477741 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 39 | 915723 | 916034 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 40 | 2278810 | 2279055 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 41 | 612489 | 612788 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 42 | 115184 | 115495 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 43 | 1224996 | 1225259 | - | NZ_CP042410.1 | Leuconostoc citreum |
| 44 | 467599 | 467919 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 45 | 574184 | 574453 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 46 | 570715 | 571008 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 47 | 1909086 | 1909412 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 48 | 1544858 | 1545157 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 49 | 1848618 | 1848917 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 50 | 1924448 | 1924747 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 51 | 1094440 | 1094739 | + | NZ_CP023434.1 | Suicoccus acidiformans |
| 52 | 499833 | 500147 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 53 | 106456 | 106707 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 54 | 1693699 | 1693962 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 55 | 1742247 | 1742507 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 56 | 2017949 | 2018269 | - | NZ_CP018906.1 | Lentilactobacillus curieae |
| 57 | 1492781 | 1493107 | + | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 58 | 3107296 | 3107625 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 59 | 872694 | 873002 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 60 | 334212 | 334463 | + | NZ_CP017326.1 | Weissella soli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011403.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00085.22 | 0.78 | 47 | 3183.5 | same-strand | Thioredoxin |
| 2 | PF13098.8 | 0.78 | 47 | 3183.5 | same-strand | Thioredoxin-like domain |
| 3 | PF00488.23 | 0.8 | 48 | 717.5 | same-strand | MutS domain V |
| 4 | PF01713.23 | 0.8 | 48 | 717.5 | same-strand | Smr domain |
| 5 | PF03652.17 | 1.0 | 60 | 40.0 | same-strand | Holliday junction resolvase |
| 6 | PF06135.14 | 1.0 | 60 | 469.0 | same-strand | IreB regulatory phosphoprotein |
| 7 | PF01411.21 | 1.0 | 60 | 860.0 | same-strand | tRNA synthetases class II (A) |
| 8 | PF02272.21 | 1.0 | 60 | 892.0 | same-strand | DHHA1 domain |
| 9 | PF07973.16 | 1.0 | 60 | 860.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 10 | PF00270.31 | 0.68 | 41 | 3764 | same-strand | DEAD/DEAH box helicase |
| 11 | PF00271.33 | 0.68 | 41 | 3764 | same-strand | Helicase conserved C-terminal domain |
| 12 | PF01368.22 | 0.6 | 36 | 5126.0 | same-strand | DHH family |
++ More..