| Protein name |
Putative ankyrin repeat protein RBE_0357 |
| NCBI Accession ID |
CP000087.1 |
| Organism |
Rickettsia bellii (strain RML369-C) |
| Left |
403303 |
| Right |
403596 |
| Strand |
- |
| Nucleotide Sequence |
TTGGAAAATAATATCTCAAATGTAAGGATACATTTACATAGAAAATGCGACGTAAACGAACAAGACATCTATGGTAAAACAGCACTGCATTATGCTTATACAAAAAGAAACATAGATATAATAAAGATATTACTAAAATGTCCAGGAATAAAAATATGTATAAAAGATAATGATGATTATACTCCAGTGGATTTAATTTGCTCAACTATAAGTTCATATATAGCATCATCCTTAGAAAATAAAATAGATGAGGTAGATAAACTTGGTGAAACACCACATTATGAGAATGGTTAA |
| Sequence |
MENNISNVRIHLHRKCDVNEQDIYGKTALHYAYTKRNIDIIKILLKCPGIKICIKDNDDYTPVDLICSTISSYIASSLENKIDEVDKLGETPHYENG |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of pfam13857. Profile Description: Ankyrin repeats (many copies). **The ORF matches to the profile of pfam13637. Profile Description: Ankyrin repeats (many copies). **The ORF matches to the profile of cl02529. Profile Description: Ankyrin repeat. Ankyrins are multifunctional adaptors that link specific proteins to the membrane-associated, spectrin- actin cytoskeleton. This repeat-domain is a 'membrane-binding' domain of up to 24 repeated units, and it mediates most of the protein's binding activities. |
| Pubmed ID |
16703114
|
| Domain |
CDD:404699,CDD:372654,CDD:413359 |
| Functional Category |
Others |
| Uniprot ID |
Q1RJM6
|
| ORF Length (Amino Acid) |
97 |