Result : A7H8A3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000769.1 |
| Organism | Anaeromyxobacter sp. (strain Fw109-5) |
| Left | 836916 |
| Right | 837197 |
| Strand | + |
| Nucleotide Sequence | ATGGCCGAGCTCGCGCGCGCGCACATCCTCGTGAGCGGAGAGGTGCAGGGGGTCTCGTTCCGCGCGGCCGCCGTCGACGAGGCGCGCCGGCTGGGCGTCCGCGGCTGGGTGCGGAACGTGGCCGACGGCCGCGTCGAGGCCGAGGCCGAGGGAGAGCGGGCGAAGGTGGAGGCGCTCGTCCGCTGGTGCGGCCGCGGGCCGCCCGCGGCGCGGGTCGCGGACGTGCAGGTGTCCTGGGGCGCCTACGGCGGCGACCTCGGGCCGTTCTCCGTCAGGCACTGA |
| Sequence | MAELARAHILVSGEVQGVSFRAAAVDEARRLGVRGWVRNVADGRVEAEAEGERAKVEALVRWCGRGPPAARVADVQVSWGAYGGDLGPFSVRH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 25614562 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A7H8A3 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 132
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 822030 | 822311 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 2 | 1092855 | 1093133 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 3 | 93966 | 94247 | + | NZ_CP007493.1 | Thermofilum adornatus 1505 |
| 4 | 893046 | 893327 | - | NZ_CP009961.1 | Infirmifilum uzonense |
| 5 | 375757 | 376038 | + | NC_010482.1 | Candidatus Korarchaeum cryptofilum OPF8 |
| 6 | 1447047 | 1447325 | + | NZ_CP013011.1 | Pyrodictium delaneyi |
| 7 | 523638 | 523877 | + | NC_014658.1 | Methanothermus fervidus DSM 2088 |
| 8 | 442095 | 442328 | + | NC_014961.1 | Desulfurococcus mucosus DSM 2162 |
| 9 | 591286 | 591516 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 10 | 598503 | 598775 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 11 | 1717367 | 1717639 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 12 | 1374256 | 1374537 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 13 | 1944897 | 1945148 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 14 | 990845 | 991078 | + | NC_008698.1 | Thermofilum pendens Hrk 5 |
| 15 | 1672254 | 1672547 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 16 | 955028 | 955306 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 17 | 296385 | 296666 | + | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 18 | 2084495 | 2084773 | - | NZ_CP007055.1 | Halostagnicola larsenii XH-48 |
| 19 | 325427 | 325705 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 20 | 547332 | 547577 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 21 | 331905 | 332180 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 22 | 2301379 | 2301657 | + | NZ_CP031305.1 | Natronorubrum bangense |
| 23 | 1826419 | 1826697 | + | NC_020388.1 | Natronomonas moolapensis 8.8.11 |
| 24 | 1224313 | 1224546 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 25 | 1428967 | 1429242 | - | NZ_CP006965.1 | Thermococcus paralvinellae |
| 26 | 2089295 | 2089576 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 27 | 1721803 | 1722078 | + | NC_014297.1 | Halalkalicoccus jeotgali B3 |
| 28 | 316119 | 316397 | + | NZ_CP058334.1 | Natronomonas halophila |
| 29 | 2190673 | 2190951 | + | NC_019964.1 | Halovivax ruber XH-70 |
| 30 | 1641433 | 1641711 | - | NZ_CP019327.1 | Haloterrigena daqingensis |
| 31 | 260265 | 260540 | - | NZ_CP019893.1 | Natrarchaeobaculum aegyptiacum |
| 32 | 5776969 | 5777202 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 33 | 35519 | 35785 | + | NC_022084.1 | Thermococcus litoralis DSM 5473 |
| 34 | 2514402 | 2514680 | + | NC_013743.1 | Haloterrigena turkmenica DSM 5511 |
| 35 | 754834 | 755112 | + | NC_009073.1 | Pyrobaculum calidifontis JCM 11548 |
| 36 | 1481506 | 1481787 | + | NZ_CP024047.1 | Natrarchaeobaculum sulfurireducens |
| 37 | 1297338 | 1297622 | + | NZ_CP011947.1 | Haloferax gibbonsii |
| 38 | 642053 | 642334 | + | NC_008212.1 | Haloquadratum walsbyi DSM 16790 |
| 39 | 2030344 | 2030571 | + | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 40 | 753437 | 753682 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 41 | 3069271 | 3069549 | - | NZ_CP034345.1 | Haloplanus rallus |
| 42 | 712037 | 712318 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 43 | 1003448 | 1003726 | - | NZ_CP040637.1 | Natrinema pallidum |
| 44 | 276885 | 277160 | + | NZ_CP023154.1 | Pyrococcus furiosus DSM 3638 |
| 45 | 1643552 | 1643779 | - | NC_000868.1 | Pyrococcus abyssi GE5 |
| 46 | 662594 | 662872 | + | NC_021921.1 | Halorhabdus tiamatea SARL4B |
| 47 | 263125 | 263364 | - | NC_009376.1 | Pyrobaculum arsenaticum DSM 13514 |
| 48 | 373976 | 374254 | - | NC_019792.1 | Natronobacterium gregoryi SP2 |
| 49 | 174596 | 174871 | - | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 50 | 456508 | 456783 | + | NZ_LN999010.1 | Thermococcus chitonophagus |
| 51 | 2068781 | 2069065 | + | NZ_CP048738.1 | Haloferax alexandrinus |
| 52 | 957392 | 957667 | + | NC_022521.1 | Aeropyrum camini SY1 = JCM 12091 |
| 53 | 1279029 | 1279313 | + | NC_013967.1 | Haloferax volcanii DS2 |
| 54 | 1008969 | 1009202 | + | NC_000854.2 | Aeropyrum pernix K1 |
| 55 | 1319368 | 1319643 | - | NC_014804.1 | Thermococcus barophilus MP |
| 56 | 453127 | 453408 | - | NZ_CP062310.1 | Infirmifilum lucidum |
| 57 | 1566795 | 1567025 | + | NZ_CP062310.1 | Infirmifilum lucidum |
| 58 | 690977 | 691255 | + | NZ_CP016804.1 | Halodesulfurarchaeum formicicum |
| 59 | 270758 | 271033 | + | NC_000961.1 | Pyrococcus horikoshii OT3 |
| 60 | 2148265 | 2148543 | + | NZ_CP025066.1 | Halalkaliarchaeum desulfuricum |
| 61 | 1210855 | 1211130 | + | NC_015680.1 | Pyrococcus yayanosii CH1 |
| 62 | 4887876 | 4888124 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 63 | 6826332 | 6826619 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 64 | 2815366 | 2815602 | + | NZ_AP017558.1 | Halopenitus persicus |
| 65 | 130152 | 130382 | + | NZ_CP012333.1 | Labilithrix luteola |
| 66 | 800190 | 800468 | + | NC_013158.1 | Halorhabdus utahensis DSM 12940 |
| 67 | 10868028 | 10868258 | - | NZ_CP016211.1 | Minicystis rosea |
| 68 | 2811982 | 2812260 | - | NZ_CP031150.1 | Haloplanus rubicundus |
| 69 | 1059461 | 1059736 | + | NC_012883.1 | Thermococcus sibiricus MM 739 |
| 70 | 1490551 | 1490838 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 71 | 2131433 | 2131672 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 72 | 1570245 | 1570499 | + | NZ_CP058529.1 | Halobaculum halophilum |
| 73 | 3597949 | 3598203 | + | NZ_CP058335.1 | Natronomonas salina |
| 74 | 296255 | 296533 | + | NZ_CP058335.1 | Natronomonas salina |
| 75 | 974311 | 974589 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 76 | 892253 | 892519 | + | NZ_CP015520.1 | Thermococcus piezophilus |
| 77 | 1451253 | 1451531 | + | NZ_LN831302.1 | Halobacterium hubeiense |
| 78 | 291851 | 292078 | - | NZ_CP006019.1 | Palaeococcus pacificus DY20341 |
| 79 | 9024529 | 9024771 | - | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 80 | 2026724 | 2027002 | + | NZ_CP058910.1 | Halosimplex rubrum |
| 81 | 1441081 | 1441359 | - | NZ_CP034940.1 | Halorubrum ezzemoulense |
| 82 | 2444210 | 2444488 | - | NZ_CP034145.1 | Haloplanus aerogenes |
| 83 | 4197163 | 4197444 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 84 | 1143092 | 1143328 | + | NZ_CP081958.1 | Halobaculum magnesiiphilum |
| 85 | 3016531 | 3016809 | - | NZ_CP058909.1 | Halosimplex pelagicum |
| 86 | 224323 | 224610 | + | NC_010525.1 | Pyrobaculum neutrophilum V24Sta |
| 87 | 1960952 | 1961227 | + | NZ_CP014862.1 | Thermococcus profundus |
| 88 | 1177737 | 1178015 | + | NC_019962.1 | Natrinema pellirubrum DSM 15624 |
| 89 | 1729971 | 1730225 | - | NZ_CP026309.1 | Salinigranum rubrum |
| 90 | 1130966 | 1131232 | - | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 91 | 1691148 | 1691396 | - | NZ_CP058579.1 | Halobaculum salinum |
| 92 | 1813627 | 1813893 | - | NZ_LR881183.1 | Thermococcus camini |
| 93 | 1363330 | 1363596 | - | NC_011529.1 | Thermococcus onnurineus NA1 |
| 94 | 2190657 | 2190923 | - | NZ_CP040846.1 | Thermococcus indicus |
| 95 | 1234749 | 1235015 | - | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 96 | 1809538 | 1809816 | - | NC_007426.1 | Natronomonas pharaonis DSM 2160 |
| 97 | 717489 | 717767 | - | NZ_CP065856.1 | Halosimplex litoreum |
| 98 | 52866 | 53105 | + | NZ_AP018732.1 | Conexivisphaera calida |
| 99 | 1216508 | 1216783 | + | NZ_CP014854.1 | Thermococcus celer Vu 13 = JCM 8558 |
| 100 | 2358767 | 2359027 | - | NZ_CP041335.1 | Chitinolyticbacter meiyuanensis |
| 101 | 315985 | 316260 | + | NZ_CP060782.1 | Sphingomonas sediminicola |
| 102 | 2379238 | 2379507 | + | NZ_CP032624.1 | Gryllotalpicola protaetiae |
| 103 | 1043318 | 1043572 | + | NC_006396.1 | Haloarcula marismortui ATCC 43049 |
| 104 | 1163497 | 1163772 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 105 | 3066180 | 3066413 | - | NZ_CP059467.1 | Aromatoleum bremense |
| 106 | 887473 | 887727 | - | NZ_CP073366.1 | Haloarcula sinaiiensis ATCC 33800 |
| 107 | 4244456 | 4244692 | - | NZ_CP059164.1 | Nocardioides ungokensis |
| 108 | 3781863 | 3782129 | - | NZ_CP038033.1 | Nitrosococcus wardiae |
| 109 | 2913689 | 2913949 | + | NZ_CP038266.1 | Microbacterium wangchenii |
| 110 | 2441747 | 2442016 | + | NZ_CP011502.1 | Aeromicrobium erythreum |
| 111 | 1529039 | 1529272 | - | NZ_CP026999.1 | Bifidobacterium longum |
| 112 | 2122378 | 2122611 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 113 | 3235747 | 3236040 | + | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 114 | 2609971 | 2610204 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 115 | 608986 | 609222 | + | NZ_CP022579.1 | Oryzomicrobium terrae |
| 116 | 1681127 | 1681402 | + | NZ_CP019154.1 | Haloarcula taiwanensis |
| 117 | 2791243 | 2791482 | - | NZ_CP011807.3 | Pandoraea faecigallinarum |
| 118 | 430900 | 431169 | - | NZ_CP028913.1 | Agromyces badenianii |
| 119 | 907649 | 907924 | - | NZ_CP018762.1 | Microbacterium aurum |
| 120 | 956805 | 957035 | - | NZ_CP025682.1 | Azoarcus pumilus |
| 121 | 2918923 | 2919171 | - | NC_023018.2 | Pandoraea pnomenusa |
| 122 | 1108452 | 1108709 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 123 | 3083430 | 3083669 | - | NZ_CP010897.2 | Pandoraea vervacti |
| 124 | 2587541 | 2587810 | + | NZ_CP060711.1 | Thermomonas brevis |
| 125 | 2336725 | 2336958 | - | NZ_CP017146.1 | Marisediminicola antarctica |
| 126 | 3051881 | 3052120 | - | NZ_CP011253.3 | Pandoraea oxalativorans |
| 127 | 4130134 | 4130409 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 128 | 380841 | 381080 | - | NZ_CP027792.1 | Pulveribacter suum |
| 129 | 1223973 | 1224254 | + | NZ_CP060035.1 | Sphingobium fuliginis |
| 130 | 1953996 | 1954229 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 131 | 859052 | 859318 | - | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 132 | 2815472 | 2815738 | + | NZ_CP044232.1 | Microbacterium lushaniae |
| 133 | 1540160 | 1540420 | + | NZ_CP012946.1 | Blastochloris viridis |
| 134 | 111857 | 112165 | + | NZ_CP064781.1 | Azospira restricta |
++ More..