Result : Q1RHR3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB |
| NCBI Accession ID | CP000087.1 |
| Organism | Rickettsia bellii (strain RML369-C) |
| Left | 1119876 |
| Right | 1120163 |
| Strand | + |
| Nucleotide Sequence | ATGGCACAGATAGTTAAAGCAACAGAAGCCGTTCGTTCATTTTCCGATATTATTAACCGTGTTTATTATAAAGGCGAAAGCTTTGATATTCAAAAAGGTAATAATATCGTGGCACAAATTACACCTGTCGAAAATAAATCTTCTGTAAAAGTAAAAAATTTAGATGAACTTTTTAAAAATGGTCCACATCTCGACCCTGAGGATGCTGAACAATTTATGAAAGATGTTGATGATGTAAGACGTAGTACTAGAATAAACATTGAGGAGTTGTATCGTAAATGGGATTAA |
| Sequence | MAQIVKATEAVRSFSDIINRVYYKGESFDIQKGNNIVAQITPVENKSSVKVKNLDELFKNGPHLDPEDAEQFMKDVDDVRRSTRINIEELYRKWD |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Partially neutralizes the RNase activity of cognate toxin VapC. {ECO:0000269|Pubmed:22046301}. |
| Pubmed ID | 16703114 22046301 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | Q1RHR3 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1119876 | 1120163 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| 2 | 807417 | 807704 | + | NZ_AP019563.1 | Rickettsia asiatica |
| 3 | 387144 | 387431 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 4 | 385059 | 385346 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 5 | 386526 | 386813 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 6 | 381505 | 381792 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 7 | 1274980 | 1275261 | + | NZ_LN794217.1 | Rickettsia monacensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP019864.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.86 | 6 | -9.0 | same-strand | PIN domain |
| 2 | PF00361.22 | 1.0 | 7 | 397 | same-strand | Proton-conducting membrane transporter |
| 3 | PF02897.17 | 1.0 | 7 | 2119 | same-strand | Prolyl oligopeptidase, N-terminal beta-propeller domain |
| 4 | PF03524.17 | 0.86 | 6 | 3509.0 | same-strand | Conjugal transfer protein |
| 5 | PF00420.26 | 0.86 | 6 | 3095.0 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 4L |
| 6 | PF00326.23 | 0.86 | 6 | 2119.5 | same-strand | Prolyl oligopeptidase family |
| 7 | PF01098.21 | 0.86 | 6 | 4447.5 | same-strand | Cell cycle protein |
++ More..