Result : Q1RH05
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L31 |
| NCBI Accession ID | CP000087.1 |
| Organism | Rickettsia bellii (strain RML369-C) |
| Left | 1379421 |
| Right | 1379660 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAATGGGATACATCCAGACTATAAAAAGTTTTTAATTAAAGTTGGAAGTGATGTTTTTGAAACAATGTCAACTCATCCTGCAGGTGAGATTTTAATGGATGTTGATTTTAGAAAACACCCAGCATGGAATAAAGATATTGGAAATGTAGTAAATCAGTCTAACAAAAGCATTAGTGATTTTAATAAAAGATTTTCCGGTCTTTCTTTCGGTAGTCAAAAGAAGGAAGCTAGTTAA |
| Sequence | MKNGIHPDYKKFLIKVGSDVFETMSTHPAGEILMDVDFRKHPAWNKDIGNVVNQSNKSISDFNKRFSGLSFGSQKKEAS |
| Source of smORF | Swiss-Prot |
| Function | Binds the 23S rRNA. {ECO:0000250}. |
| Pubmed ID | 16703114 |
| Domain | CDD:412343 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1RH05 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1379421 | 1379660 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 2 | 132007 | 132243 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 3 | 134781 | 135017 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 4 | 113148 | 113384 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 5 | 25822 | 26058 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 6 | 129421 | 129657 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 7 | 248368 | 248604 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 8 | 132681 | 132917 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 9 | 110135 | 110371 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 10 | 49208 | 49444 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 11 | 134509 | 134745 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 12 | 109790 | 110026 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010263.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05101.15 | 1.0 | 12 | 2110.0 | same-strand | Type IV secretory pathway, VirB3-like protein |
| 2 | PF01926.25 | 1.0 | 12 | 550.0 | same-strand | 50S ribosome-binding GTPase |
| 3 | PF02421.20 | 1.0 | 12 | 550.0 | same-strand | Ferrous iron transport protein B |
| 4 | PF00830.21 | 1.0 | 12 | -3.0 | same-strand | Ribosomal L28 family |
| 5 | PF03135.16 | 0.75 | 9 | 2427 | same-strand | CagE, TrbE, VirB family, component of type IV transporter system |
++ More..