Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L31 |
NCBI Accession ID | CP000087.1 |
Organism | Rickettsia bellii (strain RML369-C) |
Left | 1379421 |
Right | 1379660 |
Strand | - |
Nucleotide Sequence | ATGAAAAATGGGATACATCCAGACTATAAAAAGTTTTTAATTAAAGTTGGAAGTGATGTTTTTGAAACAATGTCAACTCATCCTGCAGGTGAGATTTTAATGGATGTTGATTTTAGAAAACACCCAGCATGGAATAAAGATATTGGAAATGTAGTAAATCAGTCTAACAAAAGCATTAGTGATTTTAATAAAAGATTTTCCGGTCTTTCTTTCGGTAGTCAAAAGAAGGAAGCTAGTTAA |
Sequence | MKNGIHPDYKKFLIKVGSDVFETMSTHPAGEILMDVDFRKHPAWNKDIGNVVNQSNKSISDFNKRFSGLSFGSQKKEAS |
Source of smORF | Swiss-Prot |
Function | Binds the 23S rRNA. {ECO:0000250}. |
Pubmed ID | 16703114 |
Domain | CDD:412343 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q1RH05 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1379421 | 1379660 | - | NC_007940.1 | Rickettsia bellii RML369-C |
2 | 132007 | 132243 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
3 | 134781 | 135017 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
4 | 113148 | 113384 | - | NZ_AP019563.1 | Rickettsia asiatica |
5 | 25822 | 26058 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
6 | 129421 | 129657 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
7 | 248368 | 248604 | + | NZ_LN794217.1 | Rickettsia monacensis |
8 | 132681 | 132917 | + | NC_016639.1 | Rickettsia slovaca 13-B |
9 | 110135 | 110371 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
10 | 49208 | 49444 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
11 | 134509 | 134745 | + | NC_009881.1 | Rickettsia akari str. Hartford |
12 | 109790 | 110026 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05101.15 | 1.0 | 12 | 2110.0 | same-strand | Type IV secretory pathway, VirB3-like protein |
2 | PF01926.25 | 1.0 | 12 | 550.0 | same-strand | 50S ribosome-binding GTPase |
3 | PF02421.20 | 1.0 | 12 | 550.0 | same-strand | Ferrous iron transport protein B |
4 | PF00830.21 | 1.0 | 12 | -3.0 | same-strand | Ribosomal L28 family |
5 | PF03135.16 | 0.75 | 9 | 2427 | same-strand | CagE, TrbE, VirB family, component of type IV transporter system |