Result : Q1R904
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Response regulator inhibitor for tor operon (Tor inhibitor) |
| NCBI Accession ID | CP000243.1 |
| Organism | Escherichia coli (strain UTI89 / UPEC) |
| Left | 2637575 |
| Right | 2637775 |
| Strand | + |
| Nucleotide Sequence | ATGCAACACGAACTACAACCTGATTCACTGGTTGATTTGAAATTCATCATGGCCGATACTGGCTTCGGTAAAACCTTCATCTATGACCGGATTAAGTCCGGCGACCTGCCAAAAGCCAAAGTTATCCACGGGCGAGCAAGATGGTTATATCGTGACCATTGTGAATTCAAAAATAAGCTCTTAAGCCGCGCCAATGGGTAA |
| Sequence | MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKLLSRANG |
| Source of smORF | Swiss-Prot |
| Function | Transcription inhibitory protein for the torCAD operon. Also acts as an excisionase and plays an essential role in the defective prophage CPS53 excision (By similarity). {ECO:0000250}. |
| Pubmed ID | 16585510 |
| Domain | |
| Functional Category | DNA-binding |
| Uniprot ID | Q1R904 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3041746 | 3041946 | + | NZ_LR134340.1 | Escherichia marmotae |
| 2 | 2476310 | 2476510 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2110144 | 2110344 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 4 | 3581208 | 3581411 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 5 | 516044 | 516244 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 6 | 1086392 | 1086589 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 7 | 356535 | 356735 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 8 | 3056191 | 3056391 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 9 | 229337 | 229516 | + | NZ_CP026364.1 | Proteus hauseri |
++ More..