Result : Q1R5B5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein DinQ |
| NCBI Accession ID | |
| Organism | Escherichia coli (strain UTI89 / UPEC) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MSKRMHSHSIAWRKRVIDKAIIVLGALIALLELIRFLLQLLN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 16585510 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q1R5B5 |
| ORF Length (Amino Acid) | 42 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3607132 | 3607260 | - | NZ_AP014857.1 | Escherichia albertii |
| 2 | 3647705 | 3647833 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3623390 | 3623518 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2572780 | 2572908 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 4135117 | 4135245 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 315215 | 315343 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 7 | 4382142 | 4382270 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 8 | 2678531 | 2678638 | + | NZ_CP011254.1 | Serratia fonticola |
| 9 | 3084960 | 3085076 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 10 | 3040090 | 3040197 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 11 | 1016208 | 1016312 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 12 | 2096401 | 2096517 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07992.16 | 0.64 | 7 | 54.0 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
++ More..