ProsmORF-pred
Result : Q1QWP1
Protein Information
Information Type Description
Protein name (2R)-sulfolactate sulfo-lyase subunit alpha (EC 4.4.1.24) (Sulfolactate sulfo-lyase A)
NCBI Accession ID CP000285.1
Organism Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Left 2010413
Right 2010697
Strand +
Nucleotide Sequence ATGAGCATCGATTTCGTGGTCCACGACGCCGACGACGCGGTCGGCGTGGTGGTGGTGGAAGGGGTGGAGGCCGGTCAGATGCTGACCGGCTGGGTGATGGATCAGGACAGGACCCTGCAGTTCGAGGTCAAGGATGCGATCCCGATCGGCCACAAGCTGGCGATCCGCGATCTCGCCGAAGACGAGACGGTCATCAAGTACAGCGTCGATATCGGCCGGGTGGTGCAGTCGATCCGCCAGGGCGAGCACGTTCACGTTCACAATGTCAAAACCAAGAGGTGGTAA
Sequence MSIDFVVHDADDAVGVVVVEGVEAGQMLTGWVMDQDRTLQFEVKDAIPIGHKLAIRDLAEDETVIKYSVDIGRVVQSIRQGEHVHVHNVKTKRW
Source of smORF Swiss-Prot
Function Together with SuyB, desulfonates sulfolactate to pyruvate and sulfite. {ECO:0000269|Pubmed:20007648}.
Pubmed ID 22675587 20007648
Domain
Functional Category Others
Uniprot ID Q1QWP1
ORF Length (Amino Acid) 94
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 38
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2010413 2010697 + NC_007963.1 Chromohalobacter salexigens DSM 3043
2 3633739 3634023 - NZ_CP065435.1 Halomonas sp. SS10-MC5
3 885037 885321 + NZ_CP021435.1 Halomonas beimenensis
4 4025168 4025452 + NZ_CP042941.1 Atlantibacter hermannii
5 571691 571972 + NZ_AP019700.1 Stella humosa
6 1198739 1199023 + NZ_CP021255.1 Desulfobulbus oralis
7 1888090 1888371 + NZ_AP014936.1 Sulfurifustis variabilis
8 164270 164503 - NZ_CP014055.2 Grimontia hollisae
9 227206 227436 + NZ_CP054626.1 Cupriavidus gilardii
10 1842378 1842662 - NZ_CP017415.1 Acidihalobacter yilgarnenesis
11 2468906 2469190 + NC_013173.1 Desulfomicrobium baculatum DSM 4028
12 1065831 1066070 + NZ_CP066076.1 Paraburkholderia ginsengisoli
13 1007082 1007312 - NC_021289.1 Caballeronia insecticola
14 1587922 1588206 + NZ_CP039543.1 Desulfovibrio marinus
15 677440 677670 + NZ_CP046915.1 Paraburkholderia acidisoli
16 684507 684737 + NZ_CP046915.1 Paraburkholderia acidisoli
17 5481774 5482004 - NZ_CP053986.1 Achromobacter denitrificans
18 480369 480599 - NZ_CP038034.1 Achromobacter insolitus
19 2583784 2584050 - NZ_LT671418.1 Herminiimonas arsenitoxidans
20 1882740 1882970 - NZ_CP016172.1 Bordetella flabilis
21 4084682 4084915 + NZ_CP016171.1 Bordetella bronchialis
22 514825 515055 + NZ_CP032519.1 Cupriavidus oxalaticus
23 451134 451364 - NC_010170.1 Bordetella petrii
24 3166605 3166835 + NZ_CP011568.3 Pandoraea thiooxydans
25 3231611 3231895 + NZ_CP014229.1 Desulfovibrio fairfieldensis
26 4325376 4325642 + NZ_CP003915.1 Advenella mimigardefordensis DPN7
27 4129833 4130066 - NZ_CP053069.1 Usitatibacter rugosus
28 3994746 3995027 + NC_017964.1 Advenella kashmirensis WT001
29 90228 90473 + NC_015589.1 Desulfotomaculum ruminis DSM 2154
30 1721457 1721702 + NC_015589.1 Desulfotomaculum ruminis DSM 2154
31 1727869 1728114 + NC_015589.1 Desulfotomaculum ruminis DSM 2154
32 623760 624005 - NC_015589.1 Desulfotomaculum ruminis DSM 2154
33 956932 957162 - NZ_CP041352.1 Casimicrobium huifangae
34 2621031 2621318 + NZ_CP018171.1 Mesorhizobium oceanicum
35 3588511 3588744 - NZ_CP053073.1 Usitatibacter palustris
36 2097461 2097745 - NZ_AP014924.1 Limnochorda pilosa
37 1355634 1355870 - NZ_CP023276.1 Polynucleobacter difficilis
38 1409528 1409794 - NZ_CP007501.1 Polynucleobacter duraquae
39 3797779 3798012 + NC_011894.1 Methylobacterium nodulans ORS 2060
40 995889 996122 - NC_008786.1 Verminephrobacter eiseniae EF01-2
41 811953 812186 + NZ_CP015421.1 Rhodovulum sulfidophilum
42 334076 334306 - NZ_CP025611.1 Niveispirillum cyanobacteriorum
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_007963.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF07702.15 0.66 25 222 opposite-strand UTRA domain
2 PF00392.23 0.71 27 236 opposite-strand Bacterial regulatory proteins, gntR family
3 PF04295.15 0.97 37 28 same-strand D-galactarate dehydratase / Altronate hydrolase, C terminus
++ More..