Result : A7GKY7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein K (SASP K) |
| NCBI Accession ID | CP000764.1 |
| Organism | Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) |
| Left | 495630 |
| Right | 495791 |
| Strand | - |
| Nucleotide Sequence | TTGGGTAGACAAGCCGAATTTTGGTCTGAGTCAAAAAACAACAGCAAAATAGATGGTCAACCGAAAGCAAAAGCACGTTTTGCTTCCAAAAGACCTAACGGCACAATTAACACGCACCCACAGGAACGTATGCGTGCTGCAAATCAGCAGGAAGAGGAATAG |
| Sequence | MGRQAEFWSESKNNSKIDGQPKAKARFASKRPNGTINTHPQERMRAANQQEEE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23915. Profile Description: Small acid-soluble spore protein K family. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. It is a minor SASP (small, acid-soluble spore protein) designated SspK. [Cellular processes, Sporulation and germination] |
| Pubmed ID | 17434157 |
| Domain | CDD:329168 |
| Functional Category | Others |
| Uniprot ID | A7GKY7 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 488106 | 488267 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 2 | 497781 | 497939 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 3 | 507092 | 507250 | - | NC_011725.1 | Bacillus cereus B4264 |
| 4 | 509226 | 509384 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 5 | 513282 | 513440 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 6 | 4613014 | 4613172 | + | NZ_CP040336.1 | Bacillus luti |
| 7 | 3640884 | 3641045 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 8 | 1364204 | 1364374 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 9 | 1113557 | 1113724 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 10 | 824982 | 825152 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 11 | 2105436 | 2105591 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 12 | 898918 | 899070 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032365.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02631.18 | 1.0 | 12 | 593.5 | opposite-strand | RecX family |
| 2 | PF08838.12 | 1.0 | 12 | 262.5 | opposite-strand | Protein of unknown function (DUF1811) |
| 3 | PF14139.8 | 0.67 | 8 | 43.0 | same-strand | YpzG-like protein |
| 4 | PF14043.8 | 0.83 | 10 | 122.5 | opposite-strand | WVELL protein |
| 5 | PF04307.16 | 0.92 | 11 | 414 | same-strand | LexA-binding, inner membrane-associated putative hydrolase |
| 6 | PF14815.8 | 0.83 | 10 | 1544.5 | opposite-strand | NUDIX domain |
| 7 | PF00730.27 | 0.83 | 10 | 1544.5 | opposite-strand | HhH-GPD superfamily base excision DNA repair protein |
| 8 | PF00633.25 | 0.75 | 9 | 1545 | opposite-strand | Helix-hairpin-helix motif |
| 9 | PF01370.23 | 0.83 | 10 | 1487.5 | same-strand | NAD dependent epimerase/dehydratase family |
| 10 | PF08338.13 | 0.83 | 10 | 1487.5 | same-strand | Domain of unknown function (DUF1731) |
++ More..