Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division protein ZapB |
NCBI Accession ID | CP000285.1 |
Organism | Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) |
Left | 3330012 |
Right | 3330221 |
Strand | + |
Nucleotide Sequence | ATGAGCCTCGAACTCTTCAACCAGCTCGAGCAAAAGGTGCAGAACGCCGTCGAGACCATCGAGATGCTGAAAATGGAGGCGGAAGAGCTGCGCGAGGAGAACACGCGCCTCAAGCAGGAGCGTGACGAGTGGGAGCGCCGCCTGAACGGGCTCCTCGGCAAGTTCCAGGAAATCGAAGACGGCAACGGCGAGACGTCCCAGACGCCTTGA |
Sequence | MSLELFNQLEQKVQNAVETIEMLKMEAEELREENTRLKQERDEWERRLNGLLGKFQEIEDGNGETSQTP |
Source of smORF | Swiss-Prot |
Function | Non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA. {ECO:0000255|HAMAP-Rule:MF_01196}. |
Pubmed ID | 22675587 |
Domain | CDD:416309 |
Functional Category | Others |
Uniprot ID | Q1QT72 |
ORF Length (Amino Acid) | 69 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3330012 | 3330221 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
2 | 1331238 | 1331477 | - | NZ_CP042382.1 | Pistricoccus aurantiacus |
3 | 3215439 | 3215630 | + | NZ_CP014226.1 | Halomonas chromatireducens |
4 | 788584 | 788784 | + | NZ_CP048812.1 | Halomonas socia |
5 | 2114649 | 2114840 | - | NZ_CP018139.1 | Halomonas aestuarii |
6 | 3454542 | 3454751 | + | NZ_CP021435.1 | Halomonas beimenensis |
7 | 521276 | 521467 | - | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
8 | 544679 | 544900 | - | NZ_CP013106.1 | Halomonas huangheensis |
9 | 2319076 | 2319279 | - | NZ_CP023559.1 | Salinicola tamaricis |
10 | 540761 | 540955 | - | NZ_AP022843.1 | Halomonas hydrothermalis |
11 | 542401 | 542595 | - | NZ_CP065135.1 | Halomonas venusta |
12 | 554237 | 554431 | - | NZ_CP048602.1 | Halomonas piezotolerans |
13 | 622297 | 622536 | + | NZ_CP021323.1 | Kushneria konosiri |
14 | 508087 | 508323 | - | NZ_AP018933.1 | Zymobacter palmae |
15 | 2684407 | 2684646 | - | NZ_CP021358.1 | Kushneria marisflavi |
16 | 345539 | 345733 | + | NZ_CP059082.1 | Halomonas titanicae |
17 | 2885776 | 2885970 | + | NZ_CP043420.1 | Kushneria phosphatilytica |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04542.16 | 0.82 | 14 | 4117.0 | opposite-strand | Sigma-70 region 2 |
2 | PF04545.18 | 0.82 | 14 | 4117.0 | opposite-strand | Sigma-70, region 4 |
3 | PF18075.3 | 0.94 | 16 | 2908.0 | opposite-strand | FtsX extracellular domain |
4 | PF00005.29 | 0.94 | 16 | 2243.0 | opposite-strand | ABC transporter |
5 | PF00448.24 | 0.94 | 16 | 859.0 | opposite-strand | SRP54-type protein, GTPase domain |
6 | PF02881.21 | 1.0 | 17 | 848 | opposite-strand | SRP54-type protein, helical bundle domain |
7 | PF03602.17 | 1.0 | 17 | 121 | same-strand | Conserved hypothetical protein 95 |
8 | PF13508.9 | 0.76 | 13 | 7 | opposite-strand | Acetyltransferase (GNAT) domain |
9 | PF01722.20 | 0.94 | 16 | 1323.0 | opposite-strand | BolA-like protein |
10 | PF07690.18 | 0.88 | 15 | 1674 | opposite-strand | Major Facilitator Superfamily |