Result : Q1MLP1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | AM236080.1 |
| Organism | Rhizobium leguminosarum bv. viciae (strain 3841) |
| Left | 667735 |
| Right | 667947 |
| Strand | + |
| Nucleotide Sequence | ATGCCTGAAGACAAGAAAGCGGCCGCCAAGGTCGAACCGCTGCGCAAGACGCGCCCTTGCCCCGAATGCGGCAAACCTTCCAACCGCGAACATTACCCCTTCTGCTCCAACCGCTGCCGCGAGGCCGATCTCTCCCGCTGGCTGACCGGCGCCTATGCCATTCCGGTTGCCGACGATGAGACCAAGGCCGAATATCCCGATGGGGAAAACTAG |
| Sequence | MPEDKKAAAKVEPLRKTRPCPECGKPSNREHYPFCSNRCREADLSRWLTGAYAIPVADDETKAEYPDGEN |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | 16640791 |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q1MLP1 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 37
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2035684 | 2035896 | - | NZ_CP054021.1 | Rhizobium indicum |
| 2 | 622983 | 623195 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 3 | 761736 | 761948 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 4 | 636789 | 637001 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 5 | 613817 | 614029 | + | NZ_CP020906.1 | Rhizobium etli |
| 6 | 2423277 | 2423489 | + | NZ_CP071454.1 | Rhizobium lentis |
| 7 | 630619 | 630831 | + | NZ_CP071604.1 | Rhizobium binae |
| 8 | 249615 | 249827 | + | NZ_CP034998.1 | Rhizobium acidisoli |
| 9 | 582707 | 582919 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 10 | 3714745 | 3714957 | - | NZ_CP054027.1 | Rhizobium hidalgonense |
| 11 | 623554 | 623763 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 12 | 600891 | 601103 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 13 | 620996 | 621172 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 14 | 3198805 | 3198975 | - | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 15 | 3773846 | 3774052 | - | NZ_CP032694.1 | Rhizobium jaguaris |
| 16 | 558501 | 558710 | + | NZ_HG938354.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 17 | 734831 | 735040 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 18 | 481950 | 482156 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 19 | 196478 | 196684 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 20 | 483982 | 484191 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 21 | 248150 | 248362 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 22 | 2352424 | 2352606 | - | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 23 | 270861 | 271073 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 24 | 683264 | 683476 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 25 | 4409982 | 4410197 | + | NZ_CP010803.1 | Martelella endophytica |
| 26 | 218887 | 219099 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 27 | 2942381 | 2942551 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 28 | 219523 | 219735 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 29 | 175384 | 175611 | - | NZ_CP053856.1 | Rhizobium pusense |
| 30 | 176805 | 177029 | - | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 31 | 1604523 | 1604726 | + | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 32 | 2996930 | 2997142 | - | NZ_CP017940.1 | Phyllobacterium zundukense |
| 33 | 1891465 | 1891644 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 34 | 872922 | 873122 | + | NZ_CP041690.1 | Youhaiella tibetensis |
| 35 | 654703 | 654903 | - | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 36 | 2842479 | 2842688 | - | NZ_CP021330.1 | Maritalea myrionectae |
| 37 | 324500 | 324682 | + | NC_007964.1 | Nitrobacter hamburgensis X14 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP054021.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02545.16 | 1.0 | 37 | 14 | same-strand | Maf-like protein |
| 2 | PF01176.21 | 0.97 | 36 | 685.0 | same-strand | Translation initiation factor 1A / IF-1 |
| 3 | PF06793.14 | 0.97 | 36 | 1530.5 | same-strand | Uncharacterised protein family (UPF0262) |
| 4 | PF00815.22 | 0.97 | 36 | 2006.0 | same-strand | Histidinol dehydrogenase |
++ More..