Result : Q1J886
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0298 protein MGAS10750_Spy0325 |
| NCBI Accession ID | CP000262.1 |
| Organism | Streptococcus pyogenes serotype M4 (strain MGAS10750) |
| Left | 335922 |
| Right | 336215 |
| Strand | + |
| Nucleotide Sequence | ATGTTTCAAAAACAAGAACGTATTGGACTCGTCGTTTACCTGTATTATAACCGAGATGCCAGAAAGTTATCAAAATTTGGTGATTTATATTACCATTCCAAGCGCTCTCGTTACCTCATTATTTATATTAATAAAAATGATTTAGACACAAAATTAGAAGAAATGAGACGTTTGAAATGTGTTAAAGACATTAGACCATCAGCTTTTGATGATATTGACCGCCAATTTGTAGGTAACCTTCATCGCGACGAAACAAACAACCATCAAAAGGGTTACCAACCCCCTAGTTACTGA |
| Sequence | MFQKQERIGLVVYLYYNRDARKLSKFGDLYYHSKRSRYLIIYINKNDLDTKLEEMRRLKCVKDIRPSAFDDIDRQFVGNLHRDETNNHQKGYQPPSY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
| Pubmed ID | 16636287 |
| Domain | CDD:420011 |
| Functional Category | Others |
| Uniprot ID | Q1J886 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 124135 | 124422 | - | NZ_LR134293.1 | Streptococcus canis |
| 2 | 455605 | 455895 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 3 | 365484 | 365768 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 4 | 1519497 | 1519742 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 5 | 1758900 | 1759148 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 6 | 1429453 | 1429701 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 7 | 293039 | 293290 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 8 | 1676268 | 1676519 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 9 | 1233806 | 1234054 | + | NZ_CP043405.1 | Streptococcus ratti |
| 10 | 992668 | 992904 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 11 | 454241 | 454498 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 12 | 370599 | 370859 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 13 | 1836805 | 1837065 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 14 | 47936 | 48184 | + | NZ_CP013237.1 | Streptococcus mutans |
| 15 | 60819 | 61070 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 16 | 1365923 | 1366174 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 17 | 1427168 | 1427416 | - | NZ_LS483343.1 | Streptococcus ferus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR594046.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06133.13 | 0.76 | 13 | -7 | same-strand | Control of competence regulator ComK, YlbF/YmcA |
| 2 | PF00574.25 | 1.0 | 17 | 542 | same-strand | Clp protease |
| 3 | PF14681.8 | 1.0 | 17 | 1494 | same-strand | Uracil phosphoribosyltransferase |
| 4 | PF13458.8 | 0.88 | 15 | 111 | same-strand | Periplasmic binding protein |
| 5 | PF01094.30 | 0.88 | 15 | 111 | same-strand | Receptor family ligand binding region |
| 6 | PF02653.18 | 0.88 | 15 | 1970.0 | same-strand | Branched-chain amino acid transport system / permease component |
| 7 | PF00005.29 | 0.88 | 15 | 3743.5 | same-strand | ABC transporter |
| 8 | PF12399.10 | 0.88 | 15 | 3197 | same-strand | Branched-chain amino acid ATP-binding cassette transporter |
++ More..