Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0298 protein MGAS10750_Spy0325 |
NCBI Accession ID | CP000262.1 |
Organism | Streptococcus pyogenes serotype M4 (strain MGAS10750) |
Left | 335922 |
Right | 336215 |
Strand | + |
Nucleotide Sequence | ATGTTTCAAAAACAAGAACGTATTGGACTCGTCGTTTACCTGTATTATAACCGAGATGCCAGAAAGTTATCAAAATTTGGTGATTTATATTACCATTCCAAGCGCTCTCGTTACCTCATTATTTATATTAATAAAAATGATTTAGACACAAAATTAGAAGAAATGAGACGTTTGAAATGTGTTAAAGACATTAGACCATCAGCTTTTGATGATATTGACCGCCAATTTGTAGGTAACCTTCATCGCGACGAAACAAACAACCATCAAAAGGGTTACCAACCCCCTAGTTACTGA |
Sequence | MFQKQERIGLVVYLYYNRDARKLSKFGDLYYHSKRSRYLIIYINKNDLDTKLEEMRRLKCVKDIRPSAFDDIDRQFVGNLHRDETNNHQKGYQPPSY |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
Pubmed ID | 16636287 |
Domain | CDD:420011 |
Functional Category | Others |
Uniprot ID | Q1J886 |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 124135 | 124422 | - | NZ_LR134293.1 | Streptococcus canis |
2 | 455605 | 455895 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
3 | 365484 | 365768 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
4 | 1519497 | 1519742 | - | NZ_LR134512.1 | Streptococcus agalactiae |
5 | 1758900 | 1759148 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
6 | 1429453 | 1429701 | - | NZ_LR594050.1 | Streptococcus porcinus |
7 | 293039 | 293290 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
8 | 1676268 | 1676519 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
9 | 1233806 | 1234054 | + | NZ_CP043405.1 | Streptococcus ratti |
10 | 992668 | 992904 | - | NZ_CP014835.1 | Streptococcus halotolerans |
11 | 454241 | 454498 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
12 | 370599 | 370859 | + | NZ_CP014699.1 | Streptococcus pantholopis |
13 | 1836805 | 1837065 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
14 | 47936 | 48184 | + | NZ_CP013237.1 | Streptococcus mutans |
15 | 60819 | 61070 | - | NZ_CP015196.1 | Streptococcus marmotae |
16 | 1365923 | 1366174 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
17 | 1427168 | 1427416 | - | NZ_LS483343.1 | Streptococcus ferus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06133.13 | 0.76 | 13 | -7 | same-strand | Control of competence regulator ComK, YlbF/YmcA |
2 | PF00574.25 | 1.0 | 17 | 542 | same-strand | Clp protease |
3 | PF14681.8 | 1.0 | 17 | 1494 | same-strand | Uracil phosphoribosyltransferase |
4 | PF13458.8 | 0.88 | 15 | 111 | same-strand | Periplasmic binding protein |
5 | PF01094.30 | 0.88 | 15 | 111 | same-strand | Receptor family ligand binding region |
6 | PF02653.18 | 0.88 | 15 | 1970.0 | same-strand | Branched-chain amino acid transport system / permease component |
7 | PF00005.29 | 0.88 | 15 | 3743.5 | same-strand | ABC transporter |
8 | PF12399.10 | 0.88 | 15 | 3197 | same-strand | Branched-chain amino acid ATP-binding cassette transporter |