Result : Q1J1S9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000359.1 |
| Organism | Deinococcus geothermalis (strain DSM 11300 / AG-3a) |
| Left | 238873 |
| Right | 239172 |
| Strand | + |
| Nucleotide Sequence | ATGGCCGAAAAGGACATTGACAAGTTGCTTTCCCTGACCGATAGCAAGTACCGCCTGTCGGTCGTGATCGCCAAGCGCGCGCTGCAACTGCGCTCGGGCGCGCCCAGCGTGCTGCCGGTCGAGCAGCGGGTGCGGACGCGCAATCTGGTGACGCAGGCGATGCGCGAACTCGCCACCGGCAAGCTGACGGTGGGTACTGGGCTGATGGACGAGAACCGTTTCCACCAGGACTACGTGCGGCAGAAGCAGGCGCAGCTGCAAGCCCAGCTCAACGCTGAGCGCGAACGCGAACGCGACTGA |
| Sequence | MAEKDIDKLLSLTDSKYRLSVVIAKRALQLRSGAPSVLPVEQRVRTRNLVTQAMRELATGKLTVGTGLMDENRFHQDYVRQKQAQLQAQLNAERERERD |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q1J1S9 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 238873 | 239172 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 2 | 268229 | 268528 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 3 | 330400 | 330699 | + | NZ_CP021081.1 | Deinococcus ficus |
| 4 | 286993 | 287292 | + | NC_012526.1 | Deinococcus deserti VCD115 |
| 5 | 617643 | 617942 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 6 | 2393956 | 2394255 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 7 | 1690155 | 1690454 | + | NZ_CP031500.1 | Deinococcus radiodurans |
| 8 | 1269507 | 1269818 | - | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 9 | 9981 | 10280 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 10 | 2821595 | 2821894 | - | NC_017790.1 | Deinococcus gobiensis I-0 |
| 11 | 1673459 | 1673758 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 12 | 3292001 | 3292300 | - | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 13 | 547206 | 547505 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
++ More..