Result : Q1J123
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000359.1 |
| Organism | Deinococcus geothermalis (strain DSM 11300 / AG-3a) |
| Left | 537589 |
| Right | 537852 |
| Strand | + |
| Nucleotide Sequence | ATGCGCCTGACTGCTCTTGTCTCCGGTACCGTCCAGGGCGTCGGGTACCGCCGTTACGTCCAGCGCCACGCGCGCGACCTGGGCCTGTCGGGCAGCGCCGAGAATCTGCCTGACGGCCGGGTAGAGGTCGTCGCGGAAGGCCCGCCCGAGCATCTCGAACGCCTGCTGCACTGGTTGCGGCGTGGCCCGCCCCACGCCCGCGTCGCGGACGTGCAGACCCAGTACAGCGAGGCGACCGGGCTGCGGGATTTTCACGTGTACTGA |
| Sequence | MRLTALVSGTVQGVGYRRYVQRHARDLGLSGSAENLPDGRVEVVAEGPPEHLERLLHWLRRGPPHARVADVQTQYSEATGLRDFHVY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q1J123 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 220
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 537589 | 537852 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 2 | 1908426 | 1908689 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 3 | 635762 | 636025 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 4 | 1954431 | 1954694 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 5 | 1353735 | 1353998 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 6 | 2145234 | 2145497 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 7 | 1104072 | 1104335 | + | NZ_CP021081.1 | Deinococcus ficus |
| 8 | 2207277 | 2207540 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 9 | 139763 | 140026 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 10 | 1491299 | 1491523 | - | NC_015161.1 | Deinococcus proteolyticus MRP |
| 11 | 2159361 | 2159624 | - | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 12 | 3779746 | 3780009 | - | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 13 | 1617754 | 1618017 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 14 | 733469 | 733693 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 15 | 465430 | 465654 | + | NZ_CP016312.1 | Thermus brockianus |
| 16 | 528666 | 528890 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 17 | 1448614 | 1448838 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 18 | 958691 | 958915 | - | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 19 | 113118 | 113342 | - | NZ_CP038452.1 | Thermus caldilimi |
| 20 | 1265954 | 1266178 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 21 | 1085275 | 1085508 | + | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 22 | 2286793 | 2287026 | + | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 23 | 1356795 | 1357019 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 24 | 398774 | 399001 | - | NZ_CP049074.1 | Metallosphaera tengchongensis |
| 25 | 1235149 | 1235409 | - | NC_003106.2 | Sulfurisphaera tokodaii str. 7 |
| 26 | 776432 | 776680 | + | NZ_CP045483.1 | Stygiolobus azoricus |
| 27 | 1285842 | 1286102 | - | NZ_CP045484.1 | Sulfurisphaera ohwakuensis |
| 28 | 1879945 | 1880169 | + | NZ_CP012621.1 | Zobellella denitrificans |
| 29 | 2380764 | 2381000 | - | NZ_CP077717.1 | Saccharolobus shibatae B12 |
| 30 | 1818868 | 1819104 | + | NZ_CP031156.1 | Metallosphaera prunae |
| 31 | 1660441 | 1660701 | + | NZ_CP033238.1 | Saccharolobus solfataricus |
| 32 | 2122378 | 2122611 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 33 | 2154333 | 2154605 | - | NZ_CP020477.1 | Acidianus manzaensis |
| 34 | 489938 | 490213 | + | NC_015435.1 | Metallosphaera cuprina Ar-4 |
| 35 | 1212804 | 1213064 | + | NZ_CP020364.1 | Sulfolobus acidocaldarius |
| 36 | 2120915 | 2121154 | - | NZ_CP058215.1 | Methanolobus zinderi |
| 37 | 1216508 | 1216783 | + | NZ_CP014854.1 | Thermococcus celer Vu 13 = JCM 8558 |
| 38 | 2152512 | 2152754 | + | NZ_LT828648.1 | Nitrospira japonica |
| 39 | 769275 | 769550 | + | NC_017096.1 | Caldisericum exile AZM16c01 |
| 40 | 2495835 | 2496089 | + | NZ_CP020931.1 | Marinobacter salarius |
| 41 | 1363330 | 1363596 | - | NC_011529.1 | Thermococcus onnurineus NA1 |
| 42 | 1790448 | 1790720 | - | NZ_CP029288.2 | Acidianus sulfidivorans JP7 |
| 43 | 330048 | 330275 | - | NC_012804.1 | Thermococcus gammatolerans EJ3 |
| 44 | 142527 | 142802 | + | NZ_LT900021.1 | Thermococcus henrietii |
| 45 | 492372 | 492641 | + | NZ_AP017372.2 | Halorhodospira halochloris |
| 46 | 975407 | 975679 | - | NZ_AP018930.1 | Sulfuracidifex tepidarius |
| 47 | 943846 | 944073 | - | NZ_CP014750.1 | Thermococcus peptonophilus |
| 48 | 293738 | 293965 | + | NZ_CP008887.1 | Thermococcus eurythermalis |
| 49 | 456508 | 456783 | + | NZ_LN999010.1 | Thermococcus chitonophagus |
| 50 | 753437 | 753682 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 51 | 1223222 | 1223482 | - | NC_015518.1 | Acidianus hospitalis W1 |
| 52 | 287907 | 288167 | - | NZ_CP045482.1 | Acidianus ambivalens |
| 53 | 979627 | 979902 | - | NZ_CP007140.1 | Thermococcus guaymasensis DSM 11113 |
| 54 | 1520142 | 1520378 | - | NZ_CP015101.1 | Thermococcus barossii |
| 55 | 291851 | 292078 | - | NZ_CP006019.1 | Palaeococcus pacificus DY20341 |
| 56 | 1944897 | 1945148 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 57 | 1825590 | 1825865 | - | NC_006624.1 | Thermococcus kodakarensis KOD1 |
| 58 | 1638128 | 1638403 | - | NC_017506.1 | Marinobacter adhaerens HP15 |
| 59 | 1383091 | 1383366 | - | NZ_CP015106.1 | Thermococcus radiotolerans |
| 60 | 319596 | 319874 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 61 | 1984379 | 1984645 | + | NZ_CP029287.2 | Metallosphaera hakonensis JCM 8857 = DSM 7519 |
| 62 | 1960952 | 1961227 | + | NZ_CP014862.1 | Thermococcus profundus |
| 63 | 8309047 | 8309274 | - | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 64 | 1972369 | 1972599 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 65 | 1475353 | 1475601 | + | NZ_CP016353.1 | Prauserella marina |
| 66 | 1871202 | 1871438 | - | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 67 | 3772221 | 3772457 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 68 | 2190657 | 2190923 | - | NZ_CP040846.1 | Thermococcus indicus |
| 69 | 1141285 | 1141521 | - | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 70 | 1191779 | 1192045 | + | NC_018015.1 | Thermococcus cleftensis |
| 71 | 1472761 | 1472997 | - | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 72 | 6740887 | 6741123 | - | NC_021252.1 | Amycolatopsis keratiniphila |
| 73 | 981625 | 981891 | + | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
| 74 | 1933310 | 1933546 | + | NZ_CP008953.1 | Amycolatopsis japonica |
| 75 | 1794296 | 1794532 | - | NZ_CP006764.1 | Corynebacterium doosanense CAU 212 = DSM 45436 |
| 76 | 3612288 | 3612515 | + | NZ_AP022562.1 | Mycobacterium novum |
| 77 | 2836503 | 2836730 | - | NC_015576.1 | Mycolicibacter sinensis |
| 78 | 598524 | 598775 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 79 | 2234908 | 2235177 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 80 | 2073895 | 2074161 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 81 | 1773913 | 1774188 | - | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 82 | 3255275 | 3255502 | - | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 83 | 4050314 | 4050580 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 84 | 4377255 | 4377482 | + | NZ_CP016793.1 | Lentzea guizhouensis |
| 85 | 892253 | 892519 | + | NZ_CP015520.1 | Thermococcus piezophilus |
| 86 | 1030674 | 1030910 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 87 | 6812450 | 6812686 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 88 | 1776287 | 1776523 | - | NZ_CP011545.1 | Corynebacterium testudinoris |
| 89 | 3137945 | 3138226 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 90 | 540196 | 540432 | + | NZ_LT859958.1 | Brevefilum fermentans |
| 91 | 6772217 | 6772444 | - | NZ_CP016174.1 | Amycolatopsis orientalis |
| 92 | 1047469 | 1047747 | + | NZ_CP009249.1 | Corynebacterium phocae |
| 93 | 976617 | 976853 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 94 | 2048966 | 2049214 | + | NC_022116.1 | Amycolatopsis mediterranei RB |
| 95 | 2458416 | 2458673 | + | NZ_CP014635.1 | Corynebacterium simulans |
| 96 | 1097415 | 1097684 | + | NZ_CP068013.1 | Paenarthrobacter ureafaciens |
| 97 | 5170795 | 5171022 | + | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 98 | 2332333 | 2332563 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 99 | 355741 | 355989 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 100 | 7903650 | 7903916 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 101 | 6087248 | 6087502 | - | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 102 | 1802529 | 1802786 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
| 103 | 1912087 | 1912323 | - | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
| 104 | 3955174 | 3955434 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 105 | 4130155 | 4130409 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 106 | 1004634 | 1004858 | + | NZ_AP018560.1 | Aerosticca soli |
| 107 | 882922 | 883161 | + | NZ_CP035299.1 | Corynebacterium pelargi |
| 108 | 2084695 | 2084931 | - | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 109 | 1724529 | 1724753 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 110 | 4300473 | 4300742 | - | NC_007777.1 | Frankia casuarinae |
| 111 | 2777524 | 2777751 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 112 | 10080438 | 10080665 | - | NZ_CP012752.1 | Kibdelosporangium phytohabitans |
| 113 | 4344380 | 4344628 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 114 | 4727325 | 4727576 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 115 | 1124409 | 1124720 | + | NZ_LR134350.1 | Actinomyces howellii |
| 116 | 1818769 | 1819002 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 117 | 1857048 | 1857329 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 118 | 847701 | 847967 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 119 | 2379247 | 2379507 | + | NZ_CP032624.1 | Gryllotalpicola protaetiae |
| 120 | 397633 | 397896 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 121 | 4783468 | 4783698 | + | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 122 | 4969642 | 4969872 | + | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 123 | 2836130 | 2836378 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 124 | 1339351 | 1339617 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 125 | 1610965 | 1611177 | + | NZ_CP020468.1 | Actinomyces gaoshouyii |
| 126 | 2457355 | 2457603 | + | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 127 | 2105936 | 2106172 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 128 | 2050817 | 2051065 | + | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 129 | 3218657 | 3218884 | - | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 130 | 1660075 | 1660356 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 131 | 1084000 | 1084266 | + | NZ_CP009248.1 | Corynebacterium sphenisci DSM 44792 |
| 132 | 4187143 | 4187424 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 133 | 289599 | 289835 | + | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
| 134 | 1141217 | 1141444 | + | NZ_CP006841.1 | Corynebacterium lactis RW2-5 |
| 135 | 1568405 | 1568698 | + | NZ_CP022752.1 | Actinopolyspora erythraea |
| 136 | 7952784 | 7953020 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| 137 | 5302690 | 5302929 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 138 | 1002147 | 1002389 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 139 | 5294116 | 5294364 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 140 | 550970 | 551251 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 141 | 2761814 | 2762065 | - | NZ_CP023688.1 | Streptomyces rimosus |
| 142 | 3578178 | 3578405 | + | NC_015578.1 | Treponema primitia ZAS-2 |
| 143 | 1774615 | 1774851 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 144 | 3217235 | 3217501 | - | NZ_CP023525.1 | Cedecea neteri |
| 145 | 4323534 | 4323770 | - | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 146 | 3337574 | 3337822 | - | NZ_CP064030.1 | Dyella caseinilytica |
| 147 | 3730669 | 3730905 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
| 148 | 1487366 | 1487617 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 149 | 1693555 | 1693821 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 150 | 3404357 | 3404590 | - | NZ_CP018139.1 | Halomonas aestuarii |
| 151 | 3928080 | 3928325 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 152 | 1669466 | 1669699 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 153 | 1614331 | 1614564 | + | NC_015968.1 | Enterobacter soli |
| 154 | 372593 | 372820 | - | NC_016070.1 | Thermoproteus tenax Kra 1 |
| 155 | 2470270 | 2470497 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 156 | 4783466 | 4783696 | + | NZ_CP054938.1 | Streptomyces harbinensis |
| 157 | 294400 | 294681 | + | NZ_CP068168.1 | Corynebacterium amycolatum |
| 158 | 1813138 | 1813383 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 159 | 6859039 | 6859305 | - | NZ_CP023445.1 | Actinosynnema pretiosum |
| 160 | 3952425 | 3952688 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 161 | 7002683 | 7002949 | - | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 162 | 4684876 | 4685106 | + | NZ_CP009922.3 | Streptomyces xiamenensis |
| 163 | 6703393 | 6703632 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 164 | 3266264 | 3266527 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 165 | 1334222 | 1334458 | + | NC_014666.1 | Frankia inefficax |
| 166 | 830440 | 830685 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 167 | 562636 | 562863 | + | NZ_CP029642.1 | Arthrobacter dokdonellae |
| 168 | 1645545 | 1645778 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 169 | 8807955 | 8808182 | - | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 170 | 4219586 | 4219825 | - | NZ_CP019706.1 | Pantoea alhagi |
| 171 | 5094396 | 5094644 | - | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 172 | 6037791 | 6038018 | - | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 173 | 3364302 | 3364535 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 174 | 5401772 | 5402011 | + | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 175 | 3034702 | 3034968 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 176 | 2996337 | 2996570 | - | NZ_LR134201.1 | Cedecea lapagei |
| 177 | 903517 | 903750 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 178 | 1295641 | 1295868 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 179 | 877929 | 878192 | + | NZ_CP028271.1 | Mixta intestinalis |
| 180 | 1625262 | 1625495 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 181 | 1244953 | 1245195 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 182 | 3573773 | 3574006 | - | NZ_CP054254.1 | Klebsiella variicola |
| 183 | 3326055 | 3326318 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 184 | 2208381 | 2208611 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 185 | 1632619 | 1632858 | + | NZ_CP061511.1 | Mixta calida |
| 186 | 2688128 | 2688358 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 187 | 1710428 | 1710658 | + | NZ_CP026377.1 | Mixta gaviniae |
| 188 | 1948278 | 1948511 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 189 | 235812 | 236087 | - | NZ_CP015102.1 | Thermococcus pacificus |
| 190 | 3429174 | 3429416 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 191 | 1759587 | 1759829 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 192 | 1323018 | 1323260 | - | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 193 | 433038 | 433298 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 194 | 2728329 | 2728598 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 195 | 2959114 | 2959395 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 196 | 3508462 | 3508692 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 197 | 2917075 | 2917302 | - | NZ_CP029843.1 | Lysobacter maris |
| 198 | 1491088 | 1491354 | - | NZ_CP011546.1 | Corynebacterium uterequi |
| 199 | 2522400 | 2522681 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 200 | 1392216 | 1392479 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 201 | 2935517 | 2935780 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 202 | 3660879 | 3661115 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 203 | 3426334 | 3426567 | - | NZ_CP041247.1 | Raoultella electrica |
| 204 | 1711990 | 1712265 | - | NZ_CP007264.1 | Thermococcus nautili |
| 205 | 1538492 | 1538782 | + | NZ_CP006842.1 | Corynebacterium glyciniphilum AJ 3170 |
| 206 | 8884622 | 8884849 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 207 | 301821 | 302096 | - | NZ_CP015103.1 | Thermococcus siculi |
| 208 | 1798476 | 1798712 | + | NZ_CP011853.1 | Gordonia phthalatica |
| 209 | 2560034 | 2560294 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 210 | 9542368 | 9542616 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 211 | 3648454 | 3648687 | + | NZ_CP026047.1 | Raoultella planticola |
| 212 | 955770 | 956015 | + | NZ_LS483460.1 | Corynebacterium minutissimum |
| 213 | 1993818 | 1994066 | - | NZ_CP015449.1 | Dietzia lutea |
| 214 | 2203683 | 2203949 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 215 | 3596288 | 3596521 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 216 | 2511391 | 2511639 | + | NZ_AP023355.1 | Actinocatenispora thailandica |
| 217 | 1732422 | 1732664 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 218 | 928017 | 928247 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 219 | 1883277 | 1883522 | - | NZ_CP033896.1 | Corynebacterium choanae |
| 220 | 3053074 | 3053340 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
++ More..