Result : Q1J0Z7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP000359.1 |
| Organism | Deinococcus geothermalis (strain DSM 11300 / AG-3a) |
| Left | 561080 |
| Right | 561334 |
| Strand | - |
| Nucleotide Sequence | ATGAGCCATCAATGCTACTTGACCGGAAAGAAGACGATGGTGGTGAACGCGGTGATCCGCCGCGGGAAGGCCCGCCGTGAGGGTGGCGTGGGCCGCAAGACCACCGGCATCACCAAGCGCGTGCAGAAAGCCAACCTGCACAAAAAGCTCATCCGCGAAAACGGCGTGCTGAAGCGGGTATGGCTGAGCGCCGCGGCGCTGCGTACACTGAATAAAGGCCCCTACCAGGGCGTGGAGCTCGCATGCAGGTGCTGA |
| Sequence | MSHQCYLTGKKTMVVNAVIRRGKARREGGVGRKTTGITKRVQKANLHKKLIRENGVLKRVWLSAAALRTLNKGPYQGVELACRC |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1J0Z7 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 561080 | 561334 | - | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 2 | 2377104 | 2377319 | - | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 3 | 2754856 | 2755101 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 4 | 1723882 | 1724127 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 5 | 918983 | 919228 | + | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 6 | 2345757 | 2346002 | + | NZ_CP013910.1 | Deinococcus actinosclerus |
| 7 | 2581604 | 2581849 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 8 | 898220 | 898465 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 9 | 124059 | 124304 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 10 | 2675147 | 2675380 | + | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 11 | 637290 | 637511 | + | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 12 | 2506542 | 2506775 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 13 | 2507537 | 2507791 | + | NZ_CP019791.1 | Anaerohalosphaera lusitana |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008025.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00950.19 | 0.64 | 7 | 1826 | same-strand | ABC 3 transport family |
| 2 | PF00005.29 | 0.64 | 7 | 1111.5 | same-strand | ABC transporter |
| 3 | PF01297.19 | 0.82 | 9 | -3 | same-strand | Zinc-uptake complex component A periplasmic |
++ More..