Result : Q1J0V9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | CP000359.1 |
| Organism | Deinococcus geothermalis (strain DSM 11300 / AG-3a) |
| Left | 613403 |
| Right | 613606 |
| Strand | + |
| Nucleotide Sequence | ATGCCGAAGATGAAGACCAAGAAGAGCATGACCCGCCGGGTCAAGGTCACGGCCACCGGCAAAGTCATGGCATTTAAGAGTGGCAAGCGCCACCAGAACACCGGCAAGAGCGGTGACGAGATCCGCGGCAAGGGCAAGGGCTTTGTGCTCGCCAAGAGCGAGTGGGCCCGTATGAAGCTCGGGCTGCTGGCGAAGGGGAAGTGA |
| Sequence | MPKMKTKKSMTRRVKVTATGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKSEWARMKLGLLAKGK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1J0V9 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 613403 | 613606 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 2 | 799986 | 800186 | + | NZ_CP011387.1 | Deinococcus puniceus |
| 3 | 2990486 | 2990686 | - | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 4 | 987110 | 987310 | - | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 5 | 692382 | 692582 | + | NC_012526.1 | Deinococcus deserti VCD115 |
| 6 | 1234688 | 1234888 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 7 | 1352497 | 1352703 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 8 | 2717138 | 2717338 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 9 | 140634 | 140840 | + | NZ_CP010028.1 | Deinococcus radiopugnans |
| 10 | 691567 | 691767 | + | NZ_CP021081.1 | Deinococcus ficus |
| 11 | 1223555 | 1223755 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 12 | 986780 | 986977 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 13 | 1046025 | 1046225 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 14 | 1462417 | 1462614 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 15 | 514909 | 515106 | + | NC_006461.1 | Thermus thermophilus HB8 |
| 16 | 718557 | 718754 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 17 | 1799265 | 1799462 | + | NZ_CP016312.1 | Thermus brockianus |
| 18 | 157217 | 157414 | + | NZ_CP038452.1 | Thermus caldilimi |
| 19 | 2041472 | 2041669 | - | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 20 | 1236907 | 1237104 | + | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 21 | 1207836 | 1208030 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 22 | 96147 | 96344 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 23 | 812088 | 812291 | + | NZ_CP047045.1 | Terricaulis silvestris |
| 24 | 1308287 | 1308484 | + | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 25 | 98944 | 99147 | + | NC_014932.1 | Bartonella clarridgeiae 73 |
| 26 | 958873 | 959073 | - | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008025.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00453.20 | 1.0 | 26 | 8.5 | same-strand | Ribosomal protein L20 |
++ More..