| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | CP000359.1 |
| Organism | Deinococcus geothermalis (strain DSM 11300 / AG-3a) |
| Left | 1960975 |
| Right | 1961199 |
| Strand | - |
| Nucleotide Sequence | ATGAAGCTCAGTGACATGCGCGCGCTGTCGGCGGCCGATTTTGACAAGGAAATCGCGGCCCGCAAGAAGGAACTGATGGAGCTGCGCTTTCAGGCAGCGATGGGCCAGCTGGCTCAGCCGCACCGCGTCAAGCAGCTCAAGCGTGAAGTGGCGCAGCTGAACACCATTCGCAGCGAGCAGAGCCGTGCTGCGCGGGTGGCCGCCCAGACCGGAGAGAGCCAATGA |
| Sequence | MKLSDMRALSAADFDKEIAARKKELMELRFQAAMGQLAQPHRVKQLKREVAQLNTIRSEQSRAARVAAQTGESQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1IX80 |
| ORF Length (Amino Acid) | 74 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1960975 | 1961199 | - | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 2 | 1152464 | 1152664 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 3 | 445870 | 446082 | + | NZ_CP021081.1 | Deinococcus ficus |
| 4 | 2674290 | 2674490 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 5 | 2469359 | 2469562 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 6 | 2281675 | 2281875 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 7 | 422641 | 422844 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 8 | 1156796 | 1157002 | + | NZ_CP010028.1 | Deinococcus radiopugnans |
| 9 | 2161574 | 2161777 | + | NZ_CP031500.1 | Deinococcus radiodurans |
| 10 | 3061253 | 3061456 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 11 | 305537 | 305740 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 12 | 2950719 | 2950907 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 13 | 1720951 | 1721148 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 14 | 3307349 | 3307549 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 0.93 | 13 | 1673 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00673.23 | 1.0 | 14 | 1110.5 | same-strand | ribosomal L5P family C-terminus |
| 3 | PF00281.21 | 1.0 | 14 | 1110.5 | same-strand | Ribosomal protein L5 |
| 4 | PF17136.6 | 1.0 | 14 | 682.0 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 5 | PF00467.31 | 1.0 | 14 | 682.0 | same-strand | KOW motif |
| 6 | PF00238.21 | 1.0 | 14 | 284.0 | same-strand | Ribosomal protein L14p/L23e |
| 7 | PF00366.22 | 1.0 | 14 | -3.0 | same-strand | Ribosomal protein S17 |
| 8 | PF00252.20 | 1.0 | 14 | -13.0 | same-strand | Ribosomal protein L16p/L10e |
| 9 | PF00189.22 | 1.0 | 14 | 412.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 10 | PF07650.19 | 1.0 | 14 | 412.0 | same-strand | KH domain |
| 11 | PF00237.21 | 1.0 | 14 | 1159.5 | same-strand | Ribosomal protein L22p/L17e |
| 12 | PF00203.23 | 1.0 | 14 | 1568.0 | same-strand | Ribosomal protein S19 |
| 13 | PF03947.20 | 1.0 | 14 | 1865.5 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 14 | PF00181.25 | 1.0 | 14 | 1865.5 | same-strand | Ribosomal Proteins L2, RNA binding domain |