Result : Q1ISC0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP000360.1 |
| Organism | Koribacter versatilis (strain Ellin345) |
| Left | 1513708 |
| Right | 1514004 |
| Strand | + |
| Nucleotide Sequence | ATGGCTAAGTCGGCATATCAGATCCTCCGGAAGCCTGTGATCACGGAAAAAGGTCTGGGCGTGAAGGAAACCGAATCGACGCTGGTGTTCGAAGTCTCGGCGAATGCGACCAAGACGGAGATCAAGGAAGCGGTGCAGAAGACCTTCAAGGTGAAGGTGGACACGGTCCGCACTGCAAACTTCGTGGGCAAGGAACGCCGCCGCGGTAAATTCAGCGGCTACCGCCCCGACTGGAAGAAGGCATACGTTCGCCTGAAGACAGGCGAAAAGATGCCGGAGTACGCCGAGAACCTGTAA |
| Sequence | MAKSAYQILRKPVITEKGLGVKETESTLVFEVSANATKTEIKEAVQKTFKVKVDTVRTANFVGKERRRGKFSGYRPDWKKAYVRLKTGEKMPEYAENL |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 19201974 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1ISC0 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 37
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3938761 | 3939054 | - | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 2 | 5266200 | 5266460 | + | NZ_CP030840.1 | Acidisarcina polymorpha |
| 3 | 4075130 | 4075372 | - | NZ_CP042806.1 | Terriglobus albidus |
| 4 | 1715229 | 1715504 | - | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 5 | 4425989 | 4426231 | - | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 6 | 3425222 | 3425464 | - | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 7 | 668281 | 668574 | + | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 8 | 6660029 | 6660295 | + | NZ_CP063849.1 | Paludibaculum fermentans |
| 9 | 5780699 | 5780989 | - | NZ_CP015136.1 | Luteitalea pratensis |
| 10 | 6074945 | 6075235 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 11 | 2259110 | 2259373 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 12 | 3591842 | 3592081 | - | NZ_CP040449.1 | Aeromonas simiae |
| 13 | 3245303 | 3245584 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 14 | 4455794 | 4456075 | - | NZ_AP022188.1 | Aeromonas media |
| 15 | 2988990 | 2989229 | - | NZ_CP044060.1 | Aeromonas veronii |
| 16 | 328871 | 329110 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 17 | 124627 | 124869 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 18 | 2700084 | 2700371 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 19 | 4179027 | 4179302 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 20 | 1179377 | 1179652 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 21 | 558064 | 558351 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 22 | 392960 | 393241 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 23 | 2722066 | 2722341 | - | NZ_CP029347.1 | Saliniradius amylolyticus |
| 24 | 3127624 | 3127893 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 25 | 576994 | 577311 | + | NZ_CP068345.1 | Succinivibrio dextrinosolvens |
| 26 | 4341252 | 4341551 | - | NC_008709.1 | Psychromonas ingrahamii 37 |
| 27 | 3091526 | 3091801 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 28 | 1687123 | 1687413 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 29 | 2295343 | 2295639 | - | NZ_CP013816.1 | Piscirickettsia salmonis |
| 30 | 1067670 | 1067924 | - | NZ_LT629973.1 | Akkermansia glycaniphila |
| 31 | 2551611 | 2551865 | - | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 32 | 1077508 | 1077753 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 33 | 3133147 | 3133467 | - | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 34 | 2740463 | 2740750 | - | NC_017790.1 | Deinococcus gobiensis I-0 |
| 35 | 2977497 | 2977751 | - | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 36 | 919284 | 919538 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 37 | 3007152 | 3007421 | - | NZ_CP010855.1 | Marinovum algicola DG 898 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014963.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00252.20 | 0.92 | 34 | 2224.0 | same-strand | Ribosomal protein L16p/L10e |
| 2 | PF00189.22 | 0.97 | 36 | 1530.5 | same-strand | Ribosomal protein S3, C-terminal domain |
| 3 | PF07650.19 | 0.97 | 36 | 1530.5 | same-strand | KH domain |
| 4 | PF00237.21 | 1.0 | 37 | 1168 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00203.23 | 1.0 | 37 | 872 | same-strand | Ribosomal protein S19 |
| 6 | PF03947.20 | 1.0 | 37 | 21 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 7 | PF00181.25 | 1.0 | 37 | 21 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 8 | PF00573.24 | 1.0 | 37 | 21 | same-strand | Ribosomal protein L4/L1 family |
| 9 | PF00338.24 | 1.0 | 37 | 1344 | same-strand | Ribosomal protein S10p/S20e |
| 10 | PF00009.29 | 0.65 | 24 | 2250.5 | same-strand | Elongation factor Tu GTP binding domain |
| 11 | PF03144.27 | 0.65 | 24 | 2250.5 | same-strand | Elongation factor Tu domain 2 |
| 12 | PF03764.20 | 0.62 | 23 | 3153 | same-strand | Elongation factor G, domain IV |
| 13 | PF14492.8 | 0.62 | 23 | 3153 | same-strand | Elongation Factor G, domain III |
| 14 | PF00679.26 | 0.62 | 23 | 3153 | same-strand | Elongation factor G C-terminus |
++ More..