Result : Q1ISA4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | CP000360.1 |
| Organism | Koribacter versatilis (strain Ellin345) |
| Left | 1521546 |
| Right | 1521770 |
| Strand | + |
| Nucleotide Sequence | ATGCCTCGCACACGTAAGAAAGTAGAAGTAAAGGTAGCGCCGAAGGGCGCGAAGCTCCAGCTCAAGTGGATTCGCTCGGCGATTCAAGCGCCGGTGAAGCACAAGCTGGTGATCAAGGGACTCGGATTCACCCGCCTGAACCAGGTGATCGTACGCGAAGATTCGCCGTCGATCCGCGGCATGGTGGCGAAGGTCCCGCATTTGGTCGAGATCGTTCAGCAGTAG |
| Sequence | MPRTRKKVEVKVAPKGAKLQLKWIRSAIQAPVKHKLVIKGLGFTRLNQVIVREDSPSIRGMVAKVPHLVEIVQQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 19201974 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1ISA4 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4417397 | 4417585 | - | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 2 | 5274197 | 5274391 | + | NZ_CP030840.1 | Acidisarcina polymorpha |
| 3 | 3930551 | 3930739 | - | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 4 | 365617 | 365802 | + | NZ_CP011797.1 | Reinekea forsetii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_018014.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01176.21 | 0.75 | 3 | 3636 | same-strand | Translation initiation factor 1A / IF-1 |
| 2 | PF00557.26 | 0.75 | 3 | 2843 | same-strand | Metallopeptidase family M24 |
| 3 | PF00406.24 | 0.75 | 3 | 2100 | same-strand | Adenylate kinase |
| 4 | PF05191.16 | 0.75 | 3 | 2100 | same-strand | Adenylate kinase, active site lid |
| 5 | PF00344.22 | 1.0 | 4 | 668.0 | same-strand | SecY |
| 6 | PF00828.21 | 1.0 | 4 | 109.5 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 7 | PF03719.17 | 1.0 | 4 | 24.5 | same-strand | Ribosomal protein S5, C-terminal domain |
| 8 | PF00333.22 | 1.0 | 4 | 24.5 | same-strand | Ribosomal protein S5, N-terminal domain |
| 9 | PF00861.24 | 1.0 | 4 | 585.5 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 10 | PF00347.25 | 1.0 | 4 | 1024.0 | same-strand | Ribosomal protein L6 |
| 11 | PF00410.21 | 1.0 | 4 | 1720.0 | same-strand | Ribosomal protein S8 |
| 12 | PF00253.23 | 0.75 | 3 | 2278 | same-strand | Ribosomal protein S14p/S29e |
++ More..