Result : Q1IP20
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000360.1 |
| Organism | Koribacter versatilis (strain Ellin345) |
| Left | 2813893 |
| Right | 2814060 |
| Strand | - |
| Nucleotide Sequence | ATGTTCGGCGAACTTGGGGTTCCAGAAGTACTCTTCATACTTGGCATTGCACTCCTGATTTTCGGGCCGAAGAAGCTGGGCGACTTGGGCAAAGGTCTCGGAGAGGGCGTGCGCGGATTCAAGTCCGCACTTCGCGACGAACCGAAAAAGGAAGAGACGAAAGCATAG |
| Sequence | MFGELGVPEVLFILGIALLIFGPKKLGDLGKGLGEGVRGFKSALRDEPKKEETKA |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 19201974 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q1IP20 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1183845 | 1184027 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 2 | 1027655 | 1027837 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 3 | 841532 | 841711 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 4 | 2581976 | 2582152 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 5 | 7191966 | 7192139 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 6 | 2584637 | 2584810 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 7 | 4822043 | 4822216 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 8 | 1696773 | 1696946 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 9 | 893230 | 893430 | + | NZ_CP042806.1 | Terriglobus albidus |
| 10 | 1340837 | 1341031 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 11 | 1717431 | 1717595 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 12 | 3016229 | 3016402 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 13 | 30984 | 31169 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 14 | 3756694 | 3756864 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 15 | 2701834 | 2702019 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 16 | 1276786 | 1276947 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 17 | 1809813 | 1809977 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 18 | 2873742 | 2873885 | + | NC_013037.1 | Dyadobacter fermentans DSM 18053 |
| 19 | 1436349 | 1436504 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 20 | 4933177 | 4933338 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 21 | 2778222 | 2778392 | + | NZ_CP053435.1 | Spirosoma taeanense |
| 22 | 7426167 | 7426337 | - | NZ_CP025096.1 | Spirosoma pollinicola |
| 23 | 757788 | 757922 | + | NZ_LS483476.1 | Lederbergia lentus |
| 24 | 1778911 | 1779093 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 25 | 892965 | 893099 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 26 | 2719161 | 2719343 | - | NZ_CP016094.1 | Lacunisphaera limnophila |
| 27 | 916842 | 917015 | + | NZ_CP017479.1 | Flavobacterium gilvum |
| 28 | 988878 | 989060 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 29 | 3314784 | 3314939 | - | NZ_CP060723.1 | Pedobacter roseus |
| 30 | 556814 | 556990 | - | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
++ More..