| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Gas vesicle structural protein (GVP) |
| NCBI Accession ID | CP000360.1 |
| Organism | Koribacter versatilis (strain Ellin345) |
| Left | 2847506 |
| Right | 2847802 |
| Strand | - |
| Nucleotide Sequence | GTGGCGGTTGAAAGAGTATCGGGCGGCTCAAGCCTAATTGACGTACTTGACCGAGTACTCGACAAGGGCATCGTCATTGATGCCTGGGTGCGCATCTCACTCGTCGGCATTGACCTGATCACGGTTGAAGCTCGCGTCGTCGTCGCCTCCATCGACACCTACCTGAAGTACGCCGATGCGGTGGGATTGACGGGCCTGGTTTCACGGCCGCAACTGACCGAAGTGGTCGAAGAACCTGTGGTAGTGGAAGCTCCCGCCACGCGTCGTACCGCGCGCCCAAGCCGGCGGCGCATCTAG |
| Sequence | MAVERVSGGSSLIDVLDRVLDKGIVIDAWVRISLVGIDLITVEARVVVASIDTYLKYADAVGLTGLVSRPQLTEVVEEPVVVEAPATRRTARPSRRRI |
| Source of smORF | Swiss-Prot |
| Function | Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism at the favorable depth for growth. GvpA type proteins form the essential core of the structure. {ECO:0000255|HAMAP-Rule:MF_00576}. |
| Pubmed ID | 19201974 |
| Domain | CDD:413533 |
| Functional Category | Others |
| Uniprot ID | Q1INZ5 |
| ORF Length (Amino Acid) | 98 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3803711 | 3803971 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 2 | 1577764 | 1578024 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 3 | 1080126 | 1080371 | - | NC_014962.1 | Isosphaera pallida ATCC 43644 |
| 4 | 3188094 | 3188354 | - | NZ_CP024035.1 | Priestia aryabhattai |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07728.16 | 1.0 | 4 | 1437.0 | same-strand | AAA domain (dynein-related subfamily) |
| 2 | PF00741.20 | 0.75 | 3 | 1065 | same-strand | Gas vesicle protein |