Result : Q1IMM7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | CP000360.1 |
| Organism | Koribacter versatilis (strain Ellin345) |
| Left | 3417577 |
| Right | 3417831 |
| Strand | + |
| Nucleotide Sequence | GTGTTGATGATTCGTCTCTCGCGCCGTGGCGCGCGTAAGCAACCCCATTACCGCATTGTCGTTATCGAGAAGGACCGCGCCCGCGATGGCCGCTCCGTTGAGGTGGTTGGCACCTACAACCCGCGCACGAACCCCGGTTCCATCGAACTGAAGCGTGAGCGCGTGGAATACTGGGTCAGCAAAGGCGCCCAGATGAGCGATCGCGTGAAGAAGCTGTGGGACAAAACTCCTGCCGCTCCGGCCAGCGTAGCGTAA |
| Sequence | MLMIRLSRRGARKQPHYRIVVIEKDRARDGRSVEVVGTYNPRTNPGSIELKRERVEYWVSKGAQMSDRVKKLWDKTPAAPASVA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19201974 |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1IMM7 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 138
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4839726 | 4839968 | - | NZ_CP042806.1 | Terriglobus albidus |
| 2 | 3274943 | 3275191 | - | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 3 | 2591923 | 2592189 | + | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 4 | 2496610 | 2496867 | - | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 5 | 5414094 | 5414348 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 6 | 2933669 | 2933932 | + | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 7 | 5374412 | 5374669 | + | NZ_CP063849.1 | Paludibaculum fermentans |
| 8 | 2573663 | 2573911 | + | NZ_CP061800.1 | Desulfonema magnum |
| 9 | 285308 | 285535 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 10 | 1535166 | 1535417 | - | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 11 | 478898 | 479128 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 12 | 368212 | 368463 | + | NZ_CP027432.2 | Caminibacter pacificus |
| 13 | 2826218 | 2826475 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 14 | 262047 | 262274 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 15 | 1406187 | 1406456 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 16 | 1181299 | 1181544 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 17 | 2045521 | 2045766 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 18 | 800243 | 800512 | - | NZ_LR699114.1 | Aquicella lusitana |
| 19 | 1669968 | 1670213 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 20 | 1140678 | 1140923 | + | NZ_LR134379.1 | Slackia heliotrinireducens |
| 21 | 1385412 | 1385645 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 22 | 639644 | 639877 | + | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 23 | 2189792 | 2190046 | - | NZ_CP061799.1 | Desulfonema limicola |
| 24 | 656785 | 657048 | + | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 25 | 3552712 | 3552951 | - | NZ_CP014143.1 | Microbulbifer aggregans |
| 26 | 1166788 | 1167006 | - | NZ_CP016786.1 | Clostridium isatidis |
| 27 | 2527247 | 2527483 | - | NZ_CP028842.1 | Clostridium botulinum |
| 28 | 1502814 | 1503062 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 29 | 1050810 | 1051055 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 30 | 3619485 | 3619730 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 31 | 2200746 | 2200976 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 32 | 2881189 | 2881440 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 33 | 2600807 | 2601052 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 34 | 1430300 | 1430548 | + | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 35 | 2009188 | 2009406 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 36 | 790473 | 790703 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 37 | 2704622 | 2704873 | + | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 38 | 2789733 | 2789954 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 39 | 6787127 | 6787384 | - | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 40 | 751547 | 751795 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 41 | 2476360 | 2476608 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 42 | 418482 | 418721 | + | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 43 | 2407157 | 2407402 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 44 | 904660 | 904908 | + | NZ_CP013816.1 | Piscirickettsia salmonis |
| 45 | 503980 | 504231 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 46 | 502853 | 503077 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 47 | 918089 | 918337 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 48 | 994375 | 994623 | + | NZ_CP065211.1 | Enterococcus lactis |
| 49 | 1954439 | 1954687 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 50 | 552855 | 553103 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 51 | 892458 | 892706 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 52 | 854699 | 854947 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 53 | 1050387 | 1050632 | + | NZ_LR134483.1 | Listeria grayi |
| 54 | 1442475 | 1442705 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 55 | 942398 | 942643 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 56 | 1088665 | 1088913 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 57 | 1262692 | 1262937 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 58 | 1040747 | 1040992 | - | NZ_CP017326.1 | Weissella soli |
| 59 | 1478145 | 1478390 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 60 | 1597923 | 1598171 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 61 | 3982972 | 3983223 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 62 | 959899 | 960144 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 63 | 774413 | 774658 | + | NC_012924.1 | Streptococcus suis SC84 |
| 64 | 1507131 | 1507385 | + | NC_018691.1 | Alcanivorax dieselolei B5 |
| 65 | 1289576 | 1289827 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 66 | 1041375 | 1041620 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 67 | 1506548 | 1506793 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 68 | 1086292 | 1086537 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 69 | 1169647 | 1169874 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 70 | 1305721 | 1305966 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 71 | 940832 | 941074 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 72 | 428052 | 428297 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 73 | 1459617 | 1459862 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 74 | 34052 | 34288 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 75 | 747085 | 747300 | + | NZ_CP027563.1 | Weissella confusa |
| 76 | 1645070 | 1645291 | - | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 77 | 1675518 | 1675793 | + | NZ_LR699119.1 | Aquicella siphonis |
| 78 | 4232745 | 4232990 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 79 | 3925813 | 3926064 | - | NZ_CP037952.1 | Parashewanella spongiae |
| 80 | 1747983 | 1748204 | - | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 81 | 388238 | 388483 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 82 | 1439280 | 1439525 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 83 | 1609149 | 1609394 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 84 | 1038638 | 1038886 | - | NZ_LT906439.1 | Streptococcus merionis |
| 85 | 1024628 | 1024873 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 86 | 1887996 | 1888229 | - | NZ_HG917868.1 | Clostridium bornimense |
| 87 | 1789139 | 1789384 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 88 | 2540574 | 2540819 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 89 | 3296386 | 3296637 | - | NC_007954.1 | Shewanella denitrificans OS217 |
| 90 | 1545691 | 1545936 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 91 | 1062462 | 1062707 | - | NZ_LS483343.1 | Streptococcus ferus |
| 92 | 1148998 | 1149252 | + | NZ_CP064030.1 | Dyella caseinilytica |
| 93 | 1272689 | 1272940 | + | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 94 | 1336495 | 1336746 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 95 | 939386 | 939634 | + | NZ_CP011039.1 | Pseudoalteromonas spongiae UST010723-006 |
| 96 | 645036 | 645281 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 97 | 1380135 | 1380386 | + | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 98 | 2375339 | 2375593 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 99 | 1120899 | 1121150 | + | NC_014012.1 | Shewanella violacea DSS12 |
| 100 | 1790503 | 1790757 | - | NZ_CP014841.1 | Dyella thiooxydans |
| 101 | 265238 | 265483 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 102 | 1511646 | 1511897 | + | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 103 | 1281837 | 1282082 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 104 | 2183818 | 2184063 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 105 | 649278 | 649529 | - | NZ_CP052766.1 | Alteromonas pelagimontana |
| 106 | 1282262 | 1282513 | + | NZ_CP046670.1 | Alteromonas mediterranea |
| 107 | 854051 | 854296 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 108 | 1748887 | 1749126 | - | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 109 | 1175556 | 1175807 | + | NZ_CP041036.1 | Shewanella polaris |
| 110 | 3876735 | 3876986 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 111 | 3509323 | 3509574 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 112 | 1658496 | 1658744 | + | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 113 | 1287830 | 1288090 | + | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 114 | 1592985 | 1593236 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 115 | 918937 | 919194 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 116 | 2772502 | 2772753 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 117 | 1020694 | 1020942 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 118 | 3099774 | 3100022 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 119 | 1526278 | 1526529 | + | NC_016901.1 | Shewanella baltica OS678 |
| 120 | 834979 | 835230 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 121 | 3934959 | 3935210 | - | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 122 | 1318098 | 1318346 | + | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 123 | 1461703 | 1461954 | + | NZ_CP008849.1 | Alteromonas australica |
| 124 | 1932256 | 1932510 | - | NZ_AP018560.1 | Aerosticca soli |
| 125 | 4626608 | 4626856 | - | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 126 | 4089207 | 4089455 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 127 | 1531384 | 1531644 | + | NZ_CP035704.1 | Pseudolysobacter antarcticus |
| 128 | 2029315 | 2029578 | - | NZ_AP012273.1 | Thiolapillus brandeum |
| 129 | 2765777 | 2766025 | - | NZ_CP011025.1 | Pseudoalteromonas arctica A 37-1-2 |
| 130 | 974005 | 974253 | + | NC_007481.1 | Pseudoalteromonas translucida |
| 131 | 1038192 | 1038440 | + | NZ_CP011036.1 | Pseudoalteromonas nigrifaciens |
| 132 | 4462092 | 4462340 | - | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 133 | 2252954 | 2253202 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 134 | 339911 | 340168 | + | NZ_CP044483.1 | Acinetobacter schindleri |
| 135 | 558497 | 558745 | + | NZ_AP014635.1 | Vibrio tritonius |
| 136 | 547703 | 547951 | + | NZ_CP033078.1 | Vibrio zhugei |
| 137 | 624564 | 624833 | + | NZ_CP035708.1 | Sphaerotilus natans subsp. sulfidivorans |
| 138 | 3218930 | 3219187 | - | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 139 | 2794418 | 2794666 | - | NZ_CP051883.1 | Aeromonas salmonicida |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP063849.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01746.23 | 0.91 | 125 | 753 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 2 | PF01782.20 | 0.91 | 125 | 223 | same-strand | RimM N-terminal domain |
| 3 | PF05239.18 | 0.82 | 113 | 45 | same-strand | PRC-barrel domain |
| 4 | PF01245.22 | 0.78 | 107 | 1421 | same-strand | Ribosomal protein L19 |
| 5 | PF00448.24 | 0.66 | 91 | 209.0 | same-strand | SRP54-type protein, GTPase domain |
| 6 | PF02978.21 | 0.66 | 91 | 178 | same-strand | Signal peptide binding domain |
| 7 | PF02881.21 | 0.64 | 89 | 218.0 | same-strand | SRP54-type protein, helical bundle domain |
++ More..