Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0235 protein Acid345_4205 |
NCBI Accession ID | CP000360.1 |
Organism | Koribacter versatilis (strain Ellin345) |
Left | 4983230 |
Right | 4983520 |
Strand | + |
Nucleotide Sequence | GTGATTGAGATTCGCGAGACGTCGTCAGGCGTGAGCTTCGCGGTGCGATTGCAGCCGAAGGCGAAGAAGACGGCGATCATCGGCGAGTTGAACGGCGCGTTGAAACTGGGAGTGACGGACCCACCGATTGACGGACGCGCGAACGAAGCGCTGATACGGTTCGTTGCCGGCCTTTTGAAGGTTACGCGTTCGTCGGTTACCATAGCCGCCGGTGAATCCAGCCGCAATAAAGTGATTCGTATTGAAGGCGTAACGGCCGAGCAGGTGCGCTTTCGGCTGAAGGTCTGGTAG |
Sequence | MIEIRETSSGVSFAVRLQPKAKKTAIIGELNGALKLGVTDPPIDGRANEALIRFVAGLLKVTRSSVTIAAGESSRNKVIRIEGVTAEQVRFRLKVW |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
Pubmed ID | 19201974 |
Domain | CDD:412584 |
Functional Category | Others |
Uniprot ID | Q1IIU5 |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 482998 | 483303 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
2 | 907653 | 907943 | + | NC_018014.1 | Terriglobus roseus DSM 18391 |
3 | 3891261 | 3891551 | - | NC_014963.1 | Terriglobus saanensis SP1PR4 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00474.19 | 0.67 | 2 | 2385.0 | same-strand | Sodium:solute symporter family |
2 | PF01168.22 | 1.0 | 3 | 8 | same-strand | Alanine racemase, N-terminal domain |
3 | PF07992.16 | 0.67 | 2 | 1752.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
4 | PF00070.29 | 0.67 | 2 | 1752.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
5 | PF13826.8 | 0.67 | 2 | 2022.5 | same-strand | Domain of unknown function (DUF4188) |
6 | PF12706.9 | 0.67 | 2 | 2519.0 | opposite-strand | Beta-lactamase superfamily domain |
7 | PF13483.8 | 0.67 | 2 | 2519.0 | opposite-strand | Beta-lactamase superfamily domain |
8 | PF03631.17 | 0.67 | 2 | 3585.0 | same-strand | Virulence factor BrkB |