Result : Q1GAR5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit epsilon (RNAP epsilon subunit) (EC 2.7.7.6) (RNA polymerase epsilon subunit) (Transcriptase subunit epsilon) |
| NCBI Accession ID | CR954253.1 |
| Organism | Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) |
| Left | 652724 |
| Right | 652957 |
| Strand | - |
| Nucleotide Sequence | ATGATCTACAAAGTTTTATATCAAAAGGACAAGATCGTTAACCCACGCAGAGAAACGACCCAGACTCTCTACATGGAAGCCGACAACATTGTCCAAGCCAGAGCCCTCGTTGAACAAAACACCCCCTACAACATCGAGCTCATCCAAGAATTAACCGGCAACTCCTTGAAGTACGAACAAGAACACGCTGACTTCAAGCTGACTGCCTTTGGCCAAACTAACAGTGAAGATTAA |
| Sequence | MIYKVLYQKDKIVNPRRETTQTLYMEADNIVQARALVEQNTPYNIELIQELTGNSLKYEQEHADFKLTAFGQTNSED |
| Source of smORF | Swiss-Prot |
| Function | A non-essential component of RNA polymerase (RNAP). {ECO:0000255|HAMAP-Rule:MF_01553}. |
| Pubmed ID | 16754859 |
| Domain | CDD:416298 |
| Functional Category | Others |
| Uniprot ID | Q1GAR5 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 94
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 674505 | 674738 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 2 | 790812 | 791033 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 3 | 812831 | 813052 | - | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 4 | 606858 | 607079 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 5 | 1303728 | 1303949 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 6 | 1401338 | 1401559 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 7 | 718973 | 719197 | - | NZ_CP029476.1 | Lactobacillus apis |
| 8 | 914543 | 914767 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 9 | 846840 | 847064 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 10 | 1024786 | 1025013 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 11 | 1182023 | 1182247 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 12 | 1185877 | 1186104 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 13 | 1184126 | 1184353 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 14 | 1225350 | 1225577 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 15 | 1252753 | 1252965 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 16 | 1245703 | 1245915 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 17 | 1449307 | 1449528 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 18 | 1200193 | 1200405 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 19 | 680701 | 680913 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 20 | 1520697 | 1520912 | + | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 21 | 230334 | 230546 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 22 | 1895422 | 1895634 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 23 | 319516 | 319728 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 24 | 1140726 | 1140938 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 25 | 1292989 | 1293228 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 26 | 689409 | 689621 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 27 | 701448 | 701663 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 28 | 1908646 | 1908864 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 29 | 711426 | 711638 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 30 | 675376 | 675588 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 31 | 795544 | 795759 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 32 | 1829352 | 1829564 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 33 | 289784 | 290005 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 34 | 1261471 | 1261692 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 35 | 692749 | 692961 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 36 | 111057 | 111275 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 37 | 577714 | 577926 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 38 | 3427834 | 3428046 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 39 | 2035106 | 2035318 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 40 | 2095969 | 2096181 | + | NZ_CP065211.1 | Enterococcus lactis |
| 41 | 498199 | 498414 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 42 | 1301125 | 1301337 | - | NZ_CP023011.2 | Enterococcus hirae |
| 43 | 2406841 | 2407059 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 44 | 739371 | 739583 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 45 | 1929515 | 1929730 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 46 | 1987018 | 1987230 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 47 | 161066 | 161287 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 48 | 1604364 | 1604576 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 49 | 164633 | 164851 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 50 | 545407 | 545622 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 51 | 2191971 | 2192189 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 52 | 1181782 | 1181994 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 53 | 723956 | 724177 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 54 | 2489330 | 2489548 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 55 | 360867 | 361082 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 56 | 736487 | 736702 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 57 | 2556942 | 2557160 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 58 | 1540117 | 1540335 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 59 | 1899842 | 1900057 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 60 | 501166 | 501378 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 61 | 1290373 | 1290585 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 62 | 507519 | 507737 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 63 | 1348096 | 1348308 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 64 | 829434 | 829646 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 65 | 1621854 | 1622066 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 66 | 1512037 | 1512249 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
| 67 | 2211420 | 2211632 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 68 | 1041994 | 1042206 | - | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 69 | 1683763 | 1683975 | + | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 70 | 1443482 | 1443700 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 71 | 684888 | 685100 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 72 | 345614 | 345826 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 73 | 1504572 | 1504784 | - | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 74 | 906301 | 906531 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 75 | 150333 | 150563 | - | NC_012924.1 | Streptococcus suis SC84 |
| 76 | 1783431 | 1783649 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 77 | 169292 | 169522 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 78 | 1745392 | 1745622 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 79 | 1269155 | 1269385 | + | NZ_CP013237.1 | Streptococcus mutans |
| 80 | 707072 | 707284 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 81 | 655117 | 655329 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 82 | 562446 | 562676 | - | NZ_CP022680.1 | Streptococcus respiraculi |
| 83 | 1873458 | 1873688 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 84 | 284937 | 285167 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 85 | 822432 | 822662 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 86 | 752351 | 752563 | - | NZ_CP061835.1 | Weissella viridescens |
| 87 | 236799 | 237029 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 88 | 1804567 | 1804797 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 89 | 1089426 | 1089638 | - | NZ_CP027563.1 | Weissella confusa |
| 90 | 1700306 | 1700536 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 91 | 897175 | 897387 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 92 | 1555439 | 1555669 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 93 | 1312990 | 1313199 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 94 | 1545343 | 1545552 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP019750.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17770.3 | 0.95 | 89 | 4 | same-strand | Ribonuclease J C-terminal domain |
| 2 | PF07521.14 | 0.71 | 67 | 3 | same-strand | Zn-dependent metallo-hydrolase RNA specificity domain |
| 3 | PF01327.23 | 0.62 | 58 | 695.5 | same-strand | Polypeptide deformylase |
++ More..