Result : Q1GAM0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | CR954253.1 |
| Organism | Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) |
| Left | 715059 |
| Right | 715250 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGTTCCTGCAAGACATACTTCTAAGCAAAAGAAACGTTCACGTCGCGCTCACTTGAAGCTCAGCGTGCCAGCAATGCACTACGACGCAACTACTGGTGAATACCGTTTGAGCCACCGTGTTTCCCCTAAGGGTTACTACAAGGGTCGTCAAGTAGTCAGCGAAAACAGCGCTAGCGATAACGACTAG |
| Sequence | MAVPARHTSKQKKRSRRAHLKLSVPAMHYDATTGEYRLSHRVSPKGYYKGRQVVSENSASDND |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 16754859 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1GAM0 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 273
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 735625 | 735816 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 2 | 750405 | 750596 | - | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 3 | 745662 | 745853 | + | NZ_CP029476.1 | Lactobacillus apis |
| 4 | 873630 | 873821 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 5 | 941297 | 941488 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 6 | 1284673 | 1284861 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 7 | 1097253 | 1097444 | - | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 8 | 868078 | 868269 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 9 | 1144645 | 1144836 | - | NZ_AP018549.1 | Lactobacillus paragasseri |
| 10 | 753690 | 753878 | + | NZ_CP015444.1 | Lactobacillus helveticus |
| 11 | 927145 | 927333 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 12 | 1183277 | 1183465 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 13 | 983354 | 983554 | - | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 14 | 1141955 | 1142140 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 15 | 1488269 | 1488454 | + | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 16 | 683012 | 683197 | - | NZ_CP031513.1 | Bombilactobacillus bombi |
| 17 | 1310930 | 1311121 | + | NC_014334.2 | Lacticaseibacillus paracasei |
| 18 | 381870 | 382052 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 19 | 1260957 | 1261148 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 20 | 1300661 | 1300852 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 21 | 1837961 | 1838143 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 22 | 1083089 | 1083271 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 23 | 954292 | 954474 | + | NZ_CP024610.1 | Lactobacillus terrae |
| 24 | 1157162 | 1157350 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 25 | 430844 | 431032 | + | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 26 | 1168109 | 1168291 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 27 | 1174604 | 1174786 | - | NZ_CP017996.1 | Companilactobacillus crustorum |
| 28 | 947673 | 947858 | + | NZ_CP049366.1 | Companilactobacillus pabuli |
| 29 | 1493078 | 1493263 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 30 | 1386963 | 1387148 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 31 | 1739161 | 1739343 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 32 | 1963732 | 1963914 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 33 | 2138062 | 2138244 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 34 | 258194 | 258367 | + | NZ_CP065637.1 | Lactococcus garvieae |
| 35 | 1910002 | 1910184 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 36 | 1275611 | 1275793 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 37 | 630702 | 630884 | - | NZ_LR134293.1 | Streptococcus canis |
| 38 | 2093422 | 2093604 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 39 | 1770767 | 1770940 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 40 | 1717941 | 1718117 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 41 | 2083098 | 2083274 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 42 | 759402 | 759578 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 43 | 2008121 | 2008303 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 44 | 1636810 | 1636992 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 45 | 2377073 | 2377255 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 46 | 70428 | 70601 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 47 | 2033659 | 2033841 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 48 | 1948549 | 1948722 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 49 | 2299250 | 2299426 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 50 | 265248 | 265421 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 51 | 2225298 | 2225471 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 52 | 1883739 | 1883921 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 53 | 1892029 | 1892211 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 54 | 2095261 | 2095443 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 55 | 1978621 | 1978803 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 56 | 1557590 | 1557766 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 57 | 1219651 | 1219836 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 58 | 677526 | 677708 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 59 | 1831608 | 1831787 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 60 | 1862947 | 1863123 | - | NZ_LT906439.1 | Streptococcus merionis |
| 61 | 521601 | 521771 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 62 | 2130228 | 2130401 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 63 | 491098 | 491268 | + | NZ_LT906444.1 | Listeria welshimeri |
| 64 | 2098096 | 2098269 | - | NZ_LT906444.1 | Listeria welshimeri |
| 65 | 1388864 | 1389037 | + | NZ_CP015247.1 | Leuconostoc suionicum |
| 66 | 605441 | 605623 | - | NZ_CP022680.1 | Streptococcus respiraculi |
| 67 | 1051761 | 1051943 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 68 | 2189694 | 2189885 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 69 | 89669 | 89851 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 70 | 1685892 | 1686074 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 71 | 1934189 | 1934371 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 72 | 2056199 | 2056381 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 73 | 266850 | 267023 | - | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 74 | 643203 | 643367 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 75 | 2971550 | 2971729 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 76 | 422948 | 423118 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 77 | 2088361 | 2088534 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 78 | 483279 | 483449 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 79 | 2190971 | 2191144 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 80 | 1264443 | 1264616 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 81 | 1485675 | 1485848 | + | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 82 | 746466 | 746639 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 83 | 2129664 | 2129846 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 84 | 434188 | 434358 | - | NZ_CP042410.1 | Leuconostoc citreum |
| 85 | 90602 | 90784 | - | NZ_LS483343.1 | Streptococcus ferus |
| 86 | 1645939 | 1646121 | - | NZ_CP013237.1 | Streptococcus mutans |
| 87 | 525080 | 525262 | + | NZ_CP043405.1 | Streptococcus ratti |
| 88 | 263286 | 263468 | - | NC_012924.1 | Streptococcus suis SC84 |
| 89 | 1206918 | 1207097 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 90 | 1147125 | 1147304 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 91 | 257962 | 258144 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 92 | 1009182 | 1009361 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 93 | 1619826 | 1620005 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 94 | 1322379 | 1322555 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 95 | 476166 | 476348 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 96 | 926536 | 926715 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 97 | 1502047 | 1502214 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 98 | 827410 | 827592 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 99 | 405269 | 405442 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 100 | 1318504 | 1318683 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 101 | 1744109 | 1744282 | - | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 102 | 520161 | 520328 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 103 | 1598936 | 1599109 | + | NZ_CP027770.1 | Staphylococcus felis |
| 104 | 680420 | 680602 | - | NZ_CP014324.1 | Oenococcus oeni |
| 105 | 1117535 | 1117717 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 106 | 750013 | 750195 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 107 | 824255 | 824437 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 108 | 1039243 | 1039416 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 109 | 2169749 | 2169925 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 110 | 1224807 | 1224989 | - | NZ_CP029684.2 | Oenococcus sicerae |
| 111 | 320162 | 320329 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 112 | 1776610 | 1776798 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 113 | 630431 | 630619 | + | NZ_CP014161.1 | Aerococcus urinae |
| 114 | 822488 | 822661 | + | NZ_LR134483.1 | Listeria grayi |
| 115 | 417470 | 417634 | + | NZ_LR134483.1 | Listeria grayi |
| 116 | 1972044 | 1972217 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 117 | 2085910 | 2086083 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 118 | 878822 | 878995 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 119 | 587760 | 587933 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 120 | 1570520 | 1570693 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 121 | 220255 | 220428 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 122 | 1124474 | 1124647 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 123 | 569247 | 569420 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 124 | 804911 | 805084 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 125 | 913722 | 913895 | + | NZ_CP047361.1 | Macrococcus canis |
| 126 | 985836 | 986009 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 127 | 1658346 | 1658519 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 128 | 2855137 | 2855310 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 129 | 368582 | 368758 | + | NZ_LR134484.1 | Gemella haemolysans |
| 130 | 725284 | 725457 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 131 | 1788692 | 1788865 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 132 | 986881 | 987063 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
| 133 | 1135739 | 1135918 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 134 | 2068362 | 2068535 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 135 | 743797 | 743970 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 136 | 1810654 | 1810827 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 137 | 672019 | 672201 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 138 | 48215 | 48394 | - | NZ_CP019982.1 | Pediococcus inopinatus |
| 139 | 1804192 | 1804368 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 140 | 2183816 | 2183989 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 141 | 786562 | 786738 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 142 | 1183110 | 1183289 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 143 | 1018855 | 1019034 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 144 | 1080867 | 1081055 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 145 | 430308 | 430487 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 146 | 1289509 | 1289682 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 147 | 406708 | 406887 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 148 | 1239944 | 1240135 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 149 | 1725429 | 1725602 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 150 | 1178578 | 1178751 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 151 | 787142 | 787321 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 152 | 709464 | 709649 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 153 | 553148 | 553324 | - | NZ_CP046314.1 | Gemella morbillorum |
| 154 | 4077467 | 4077640 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 155 | 1718848 | 1719021 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 156 | 1829739 | 1829921 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 157 | 3848721 | 3848894 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 158 | 1556094 | 1556270 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 159 | 937743 | 937916 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 160 | 3732798 | 3732971 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 161 | 31740 | 31922 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 162 | 934102 | 934266 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 163 | 1810950 | 1811123 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 164 | 433997 | 434170 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 165 | 797674 | 797847 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 166 | 651573 | 651746 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 167 | 1091134 | 1091307 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 168 | 1889422 | 1889595 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 169 | 2242608 | 2242781 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 170 | 1678088 | 1678261 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 171 | 190854 | 191027 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 172 | 1618210 | 1618383 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 173 | 1759050 | 1759223 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 174 | 1696022 | 1696195 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 175 | 2284769 | 2284942 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 176 | 1879593 | 1879766 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 177 | 99725 | 99898 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 178 | 1140408 | 1140590 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 179 | 1554843 | 1555013 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 180 | 1414933 | 1415106 | + | NZ_CP040336.1 | Bacillus luti |
| 181 | 3744933 | 3745106 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 182 | 1028027 | 1028200 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 183 | 930365 | 930538 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 184 | 3948807 | 3948980 | - | NC_011725.1 | Bacillus cereus B4264 |
| 185 | 1343599 | 1343772 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 186 | 1453976 | 1454152 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 187 | 2820684 | 2820857 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 188 | 2873238 | 2873411 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 189 | 1709708 | 1709881 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 190 | 2660163 | 2660336 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 191 | 1269370 | 1269543 | + | NZ_CP012024.1 | Bacillus smithii |
| 192 | 524702 | 524875 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 193 | 1931525 | 1931698 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 194 | 2164210 | 2164389 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 195 | 1113778 | 1113951 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 196 | 1023814 | 1024002 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 197 | 2185942 | 2186118 | - | NZ_CP016540.2 | Planococcus versutus |
| 198 | 2171747 | 2171923 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 199 | 2276097 | 2276273 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 200 | 2942780 | 2942956 | + | NZ_CP013661.2 | Planococcus kocurii |
| 201 | 2320740 | 2320916 | - | NZ_CP019401.1 | Planococcus faecalis |
| 202 | 2462749 | 2462925 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 203 | 243753 | 243926 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 204 | 1343755 | 1343928 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 205 | 714458 | 714634 | + | NZ_CP023434.1 | Suicoccus acidiformans |
| 206 | 2660917 | 2661090 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 207 | 1339709 | 1339894 | - | NC_022549.1 | Acholeplasma brassicae |
| 208 | 957618 | 957791 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 209 | 299129 | 299305 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 210 | 1679672 | 1679845 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 211 | 5057461 | 5057634 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 212 | 1700206 | 1700379 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 213 | 3488121 | 3488294 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 214 | 1112459 | 1112632 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 215 | 2580181 | 2580351 | + | NZ_CP026363.1 | Brevibacillus agri |
| 216 | 2370650 | 2370820 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 217 | 1094202 | 1094369 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 218 | 1947656 | 1947835 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 219 | 621077 | 621259 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 220 | 3370820 | 3370993 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 221 | 790930 | 791106 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 222 | 457946 | 458116 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 223 | 42176 | 42349 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 224 | 1079139 | 1079312 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 225 | 691333 | 691515 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 226 | 1961854 | 1962027 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 227 | 1693545 | 1693721 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 228 | 4827568 | 4827741 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 229 | 2474162 | 2474335 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 230 | 225187 | 225360 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 231 | 1474082 | 1474255 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 232 | 58177 | 58350 | - | NZ_CP043404.1 | Bacillus safensis |
| 233 | 1343520 | 1343708 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 234 | 2429204 | 2429383 | - | NZ_CP011937.1 | Bacillus velezensis |
| 235 | 1754154 | 1754333 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 236 | 1483213 | 1483392 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 237 | 1531760 | 1531939 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 238 | 1579870 | 1580049 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 239 | 1542331 | 1542510 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 240 | 1548657 | 1548836 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 241 | 410195 | 410374 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 242 | 1575804 | 1575983 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 243 | 1567394 | 1567567 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 244 | 1661277 | 1661450 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 245 | 3814293 | 3814466 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 246 | 2023882 | 2024058 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 247 | 2046440 | 2046616 | - | NZ_CP016538.2 | Planococcus maritimus |
| 248 | 2069690 | 2069866 | - | NZ_CP059540.1 | Planococcus maritimus |
| 249 | 1842410 | 1842586 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 250 | 2707246 | 2707419 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 251 | 1702316 | 1702489 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 252 | 1202959 | 1203141 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 253 | 2058901 | 2059074 | + | NZ_CP053989.1 | Niallia circulans |
| 254 | 1411660 | 1411833 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 255 | 551462 | 551638 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 256 | 1588058 | 1588231 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 257 | 1466409 | 1466582 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 258 | 944850 | 945026 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 259 | 3302786 | 3302959 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 260 | 570419 | 570598 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 261 | 417338 | 417499 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 262 | 2669166 | 2669339 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 263 | 971305 | 971484 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| 264 | 1591605 | 1591787 | - | NZ_CP034118.1 | Staphylospora marina |
| 265 | 1406103 | 1406282 | + | NZ_CP014163.1 | Aerococcus urinaehominis |
| 266 | 2946506 | 2946682 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 267 | 1346892 | 1347065 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 268 | 3955403 | 3955576 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 269 | 4133809 | 4133982 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 270 | 1046423 | 1046596 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 271 | 3419714 | 3419890 | + | NZ_CP021434.1 | Tumebacillus avium |
| 272 | 1027570 | 1027749 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 273 | 1165680 | 1165859 | - | NZ_CP030086.1 | Polynucleobacter paneuropaeus |
| 274 | 2754307 | 2754480 | - | NZ_LS483476.1 | Lederbergia lentus |
| 275 | 1704635 | 1704817 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 276 | 1431282 | 1431461 | - | NZ_CP023276.1 | Polynucleobacter difficilis |
| 277 | 1488549 | 1488728 | - | NZ_CP007501.1 | Polynucleobacter duraquae |
| 278 | 388091 | 388270 | + | NC_009379.1 | Polynucleobacter asymbioticus QLW-P1DMWA-1 |
| 279 | 963996 | 964193 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 280 | 77380 | 77559 | + | NZ_LT615228.1 | Polynucleobacter necessarius |
| 281 | 382499 | 382672 | - | NZ_CP027563.1 | Weissella confusa |
| 282 | 1513040 | 1513213 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 283 | 590274 | 590465 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 284 | 1402114 | 1402299 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 285 | 1425027 | 1425194 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP018906.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02620.19 | 0.66 | 180 | 54 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
++ More..